Home » CHD5 » CHD5 Proteins » CHD5 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CHD5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CHD5 Recombinant Protein Antigen (NBP2-49186PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

CHD5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHD5.

Source: E. coli

Amino Acid Sequence: GYMDEKDPGAQKPRQPLEVQALPAALDRVESEDKHESPASKERAREERPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIHSR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHD5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49186.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CHD5 Recombinant Protein Antigen

  • ATP-dependent helicase CHD5
  • CHD-5
  • chromodomain helicase DNA binding protein 5
  • chromodomain-helicase-DNA-binding protein 5
  • DKFZp434N231
  • EC 3.6.1
  • EC 3.6.4.12
  • KIAA0444

Background

Changes in gene expression are associated with changes in chromatin structure, which can result from modification of histones by acetylation and methylation. In addition, SWI/SNF proteins can effect chromatin structure and gene expression by causing ATP-dependent disruption of the nucleosome and by enhancing binding of transcription factors. CHD5 belongs to a group of SWI/SNF proteins called CHD proteins, which contain a SWI/SNF-like helicase/ATPase domain, as well as a DNA-binding domain and a chromodomain that directly modifies chromatin structure (Thompson et al., 2003 (PubMed 12592387)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SMARCA1 Antibody
(2H7B8) - BSA Free
NBP2-61879
ELISA SMARCA1 Antibody (2H7B8) - BSA Free
Flow Cytometry SMARCA1 Antibody (2H7B8) - BSA Free
Immunohistochemistry SMARCA1 Antibody (2H7B8) - BSA Free
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CHD3 Antibody
(8Z6L6)
NBP3-16632
Western Blot CHD3 Antibody (8Z6L6)
Western Blot CHD3 Antibody (8Z6L6)
Western Blot CHD3 Antibody (8Z6L6)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SMARCA5/SNF2H
Antibody
NB100-55310
Western Blot SMARCA5/SNF2H Antibody
Western Blot SMARCA5/SNF2H Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: IP, WB
Brg1 Antibody
[Unconjugated]
AF5738
Western Blot Brg1 Antibody [Unconjugated]
Immunocytochemistry Brg1 Antibody [Unconjugated]
Immunocytochemistry Brg1 Antibody [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, KO, WB
n-Myc Antibody
(NMYC-1) - BSA Free
NB200-109
Western Blot n-Myc Antibody (NMYC-1) - BSA Free
Western Blot n-Myc Antibody (NMYC-1) - BSA Free
Immunocytochemistry/ Immunofluorescence n-Myc Antibody (NMYC-1) - BSA Free
(6 Publications)
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
CAMTA1 Antibody -
BSA Free
NBP1-93620
Immunocytochemistry/ Immunofluorescence CAMTA1 Antibody - BSA Free
Immunohistochemistry-Paraffin CAMTA1 Antibody - BSA Free
Immunohistochemistry-Paraffin CAMTA1 Antibody - BSA Free
(12 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
TSG Antibody
[Unconjugated]
AF756
Immunohistochemistry TSG Antibody [Unconjugated]
Immunohistochemistry TSG Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: IHC, WB
CHD6 Antibody -
BSA Free
NB100-60414
Western Blot CHD6 Antibody - BSA Free
Species: Hu
Applications: IP, WB
CHD4 Antibody
(CHD4 3F2/4) - BSA Fr
NBP2-50163
Flow Cytometry CHD4 Antibody (CHD4 3F2/4) - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, KO, WB
N-Cadherin
Antibody (13A9) - BSA
NBP1-48309
Flow (Intracellular) N-Cadherin Antibody (13A9) - BSA Free
Flow Cytometry N-Cadherin Antibody (13A9) - BSA Free
Immunocytochemistry/ Immunofluorescence N-Cadherin Antibody (13A9) - BSA Free
(2 Reviews)
(42 Publications)
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
PTEN Antibody
[Unconjugated]
AF847
Western Blot PTEN Antibody [Unconjugated]
Simple Western PTEN Antibody [Unconjugated]
Knockout Validated PTEN Antibody [Unconjugated]
(16 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
MDM2/HDM2 Antibody
(SMP14) - BSA Free
NB100-2736
Western Blot MDM2/HDM2 Antibody (SMP14) - BSA Free
Immunohistochemistry-Paraffin MDM2/HDM2 Antibody (SMP14) - BSA Free
Immunohistochemistry-Paraffin MDM2/HDM2 Antibody (SMP14) - BSA Free
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Bax Antibody (6A7)
- Azide and BSA Free
NBP1-28566
Western Blot Bax Antibody (6A7) - Azide and BSA Free
Western Blot Bax Antibody (6A7) - Azide and BSA Free
Immunohistochemistry-Frozen Bax Antibody (6A7) - Azide and BSA Free
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
DR3/TNFRSF25
[Unconjugated]
943-D3
DR3/TNFRSF25 [Unconjugated]
(7 Publications)
Species: Hu
Applications: Bind
BRM Antibody
NBP3-13283
Immunohistochemistry-Paraffin BRM Antibody
Immunohistochemistry-Paraffin BRM Antibody
Immunocytochemistry/ Immunofluorescence BRM Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(28 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for CHD5 Recombinant Protein Antigen (NBP2-49186PEP) (0)

There are no publications for CHD5 Recombinant Protein Antigen (NBP2-49186PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHD5 Recombinant Protein Antigen (NBP2-49186PEP) (0)

There are no reviews for CHD5 Recombinant Protein Antigen (NBP2-49186PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CHD5 Recombinant Protein Antigen (NBP2-49186PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHD5 Products

Research Areas for CHD5 Recombinant Protein Antigen (NBP2-49186PEP)

Find related products by research area.

Blogs on CHD5

There are no specific blogs for CHD5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103
Flow (Intracellular): N-Cadherin Antibody (13A9) [NBP1-48309] - An intracellular stain was performed on HeLa with NBP1-48309 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Mouse F(ab)2 IgG (H+L) PE-conjugated Antibody.
N-Cadherin Antibody (13A9) - BSA Free
NBP1-48309
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
p19ARF/CDKN2A Antibody - BSA Free
NB200-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CHD5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CHD5