Home » Caspase-6 » Caspase-6 Peptides and Proteins » Caspase-6 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Caspase-6 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Caspase-6 Protein (NBP1-87684PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Caspase-6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CASP6.

Source: E. coli

Amino Acid Sequence: MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CASP6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87684.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Caspase-6 Recombinant Protein Antigen

  • Apoptotic protease Mch-2
  • CASP6
  • CASP-6
  • caspase 6, apoptosis-related cysteine peptidase
  • caspase 6, apoptosis-related cysteine protease
  • Caspase6
  • Caspase-6
  • EC 3.4.22
  • Mch2
  • MCH2EC 3.4.22.59

Background

Caspases are a family of cytosolic aspartate-specific cysteine proteases involved in the initiation and execution of apoptosis. Caspase-6 is a major apoptotic executioner (1,2). It exists as a pro-domain protein and is cleaved by caspase-3 into two active subunits, an 18 kDa and a 10 kDa subunit (3). Caspase-6 cleaves among many different intracellular proteins, nuclear lamins. Lamins play a significant role in maintaining the integrity of the cell membrane, and their cleavage results in subsequent cellular breakdown and death (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC
Caspase-8 Antibody
NB100-56116
Western Blot Caspase-8 Antibody
Immunohistochemistry-Paraffin Caspase-8 Antibody
Immunohistochemistry-Paraffin Caspase-8 Antibody
(2 Reviews)
(79 Publications)
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Caspase-9 Antibody
NB100-56118
Immunohistochemistry Caspase-9 Antibody
Immunohistochemistry Caspase-9 Antibody
Immunohistochemistry Caspase-9 Antibody
(1 Review)
(28 Publications)
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Caspase-7 Antibody
(25B881.1) - BSA Free ...
NB100-56529
Western Blot Caspase-7 Antibody (25B881.1) - BSA Free
Western Blot Caspase-7 Antibody (25B881.1) - BSA Free
Immunohistochemistry-Paraffin Caspase-7 Antibody (25B881.1) - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PARP Antibody
(194C1439) - Cleaved ...
NBP2-27335
Immunocytochemistry/ Immunofluorescence PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(26 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Caspase-1 Antibody
(14F468) - BSA Free
NB100-56565
Immunohistochemistry-Paraffin Caspase-1 Antibody (14F468) - BSA Free
Western Blot Caspase-1 Antibody (14F468) - BSA Free
Western Blot Caspase-1 Antibody (14F468) - BSA Free
(72 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Bcl-xL Antibody
NB100-56104
Western Blot Bcl-xL Antibody
Immunohistochemistry-Paraffin Bcl-xL Antibody
Western Blot Bcl-xL Antibody
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Bax Antibody (6A7)
NBP1-28566
Western Blot Bax Antibody (6A7)
Western Blot Bax Antibody (6A7)
Immunohistochemistry-Frozen Bax Antibody (6A7)
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
Huntingtin Antibody
NBP3-13106
Western Blot Huntingtin Antibody
Immunohistochemistry-Paraffin Huntingtin Antibody
Immunocytochemistry/ Immunofluorescence Huntingtin Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Caspase-2 Antibody
(11B4) - BSA Free
NBP2-80096
Western Blot Caspase-2 Antibody (11B4) - BSA Free
Immunoprecipitation Caspase-2 Antibody (11B4) - BSA Free
Species: Ca, Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB

Publications for Caspase-6 Protein (NBP1-87684PEP) (0)

There are no publications for Caspase-6 Protein (NBP1-87684PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caspase-6 Protein (NBP1-87684PEP) (0)

There are no reviews for Caspase-6 Protein (NBP1-87684PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Caspase-6 Protein (NBP1-87684PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Caspase-6 Products

Research Areas for Caspase-6 Protein (NBP1-87684PEP)

Find related products by research area.

Blogs on Caspase-6.

Check out the latest blog posts on Caspase-6.
Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release
By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Caspase-6 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CASP6