![Western Blot: CACNB2 Antibody (6C1) [H00000783-M01] - CACNB2 monoclonal antibody (M01), clone 6C1. Analysis of CACNB2 expression in NIH/3T3.](http://images.novusbio.com/fullsize/CACNB2-Antibody-6C1-Western-Blot-H00000783-M01-img0008.jpg "Western Blot: CACNB2 Antibody (6C1) [H00000783-M01] - CACNB2 monoclonal antibody (M01), clone 6C1. Analysis of CACNB2 expression in NIH/3T3.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 6C1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | CACNB2 (NP_963890, 213 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ |
| Specificity | CACNB2 - calcium channel, voltage-dependent, beta 2 subunit |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CACNB2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CACNB2 Antibody (H00000783-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: CACNB2 Antibody (6C1) [H00000783-M01] - CACNB2 monoclonal antibody (M01), clone 6C1. Analysis of CACNB2 expression in PC-12.](http://images.novusbio.com/fullsize/CACNB2-Antibody-6C1-Western-Blot-H00000783-M01-img0006.jpg "Western Blot: CACNB2 Antibody (6C1) [H00000783-M01] - CACNB2 monoclonal antibody (M01), clone 6C1. Analysis of CACNB2 expression in PC-12.")
![Western Blot: CACNB2 Antibody (6C1) [H00000783-M01] - CACNB2 monoclonal antibody (M01), clone 6C1 Analysis of CACNB2 expression in Jurkat.](http://images.novusbio.com/fullsize/CACNB2-Antibody-6C1-Western-Blot-H00000783-M01-img0007.jpg "Western Blot: CACNB2 Antibody (6C1) [H00000783-M01] - CACNB2 monoclonal antibody (M01), clone 6C1 Analysis of CACNB2 expression in Jurkat.")
![ELISA: CACNB2 Antibody (6C1) [H00000783-M01] - Detection limit for recombinant GST tagged CACNB2 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/CACNB2-Antibody-6C1-ELISA-H00000783-M01-img0009.jpg "ELISA: CACNB2 Antibody (6C1) [H00000783-M01] - Detection limit for recombinant GST tagged CACNB2 is approximately 0.1ng/ml as a capture antibody.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")