Novus Biologicals products are now on bio-techne.com

ATG10 Recombinant Protein Antigen

Name: ATG10 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-38524PEP
Price: 279 USD

Images

There are currently no images for ATG10 Protein (NBP2-38524PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ATG10 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATG10. Source: E. coli Amino Acid Sequence: IGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKM Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	ATG10
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38524. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATG10 Recombinant Protein Antigen

APG10 autophagy 10-like (S. cerevisiae)
APG10
APG10L
APG10-like
ATG10 autophagy related 10 homolog (S. cerevisiae)
ATG10
Autophagy-related protein 10
DKFZp586I0418
EC 6.3.2.-
FLJ13954
PP12616
ubiquitin-like-conjugating enzyme ATG10

Background

Atg10 is a major contributor to cellular homeostasis is the ability of the cell to strike a balance between the formation and degradation/removal of its cellular components. This process of internal cellular turn-over is called autophagy (self-eating), and is facilitated by a pathway of around 16 interacting proteins in the human. APG10 interacts with LC3A to facilitate the conjugation of ATG12 to ATG5. APG10 is also able to directly interact either with ATG5 or ATG7A. A disruption to the autophagic process is now associated with the progression of several cancers, neurodegenerative disorders and cardiac pathologies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATG12 Antibody

NBP2-15501

Immunohistochemistry-Paraffin ATG12 Antibody

(4 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

ATG5 Antibody -
BSA Free

NB110-53818

Immunohistochemistry ATG5 Antibody - BSA Free

Immunohistochemistry-Paraffin ATG5 Antibody - BSA Free

(7 Reviews)

(286 Publications)

Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze

Applications: EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB

ATG7 Antibody
(683906) [Unconjugate

MAB6608

Simple Western ATG7 Antibody (683906) [Unconjugated]

Western Blot ATG7 Antibody (683906) [Unconjugated]

(1 Review)

(15 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB

GATE-16/GABARAPL2
Antibody - BSA Free

NBP2-82090

Immunohistochemistry-Paraffin GATE-16/GABARAPL2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence GATE-16/GABARAPL2 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

GABARAPL1 Antibody

NBP1-55202

Species: Hu

Applications: IHC, IHC-P, WB

Beclin 1 Antibody
- BSA Free

NB500-249

Simple Western Beclin 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence Beclin 1 Antibody - BSA Free

(9 Reviews)

(163 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB

ATG3/APG3 Antibody
(OTI3H2)

NBP2-01083

Western Blot ATG3/APG3 Antibody (OTI3H2)

Immunohistochemistry-Paraffin ATG3/APG3 Antibody (OTI3H2)

Species: Ca, Hu, Pm, Mu, Pm, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Butyrylcholinesterase/ ...

AF9024

Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]

(2 Publications)

Species: Mu, Rt

Applications: IHC, WB

Elastase Antibody
(CELA3B/1257) - Azide ...

NBP2-54301

Species: Hu, Mu, Rt

Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB

MASA Antibody

NBP2-13961

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

DBT Antibody

NBP1-89522

Immunohistochemistry-Paraffin DBT Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

WIPI1 Antibody

NBP1-88878

Immunohistochemistry-Paraffin WIPI1 Antibody

(1 Review)

(1 Publication)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, Simple Western, WB

LC3A Antibody -
BSA Free

NB100-2331

(22 Reviews)

(306 Publications)

Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze

Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB

Bcl-2 Antibody

NB100-56098

(2 Reviews)

(26 Publications)

Species: Ca, Hu, Mu, Rt

Applications: IHC, IHC-P, IP, WB

p63/TP73L Antibody
[Unconjugated]

AF1916

Immunocytochemistry p63/TP73L Antibody [Unconjugated]

Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]

(1 Review)

(24 Publications)

Species: Hu

Applications: ICC, IHC, WB

SPANXB1 Antibody

H00728695-B01P

Species: Hu

Applications: ICC/IF, IP, WB

UVRAG Antibody

NBP1-18885

(3 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, IP, KO, WB

BBS9 Antibody

NBP1-88927

(3 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

AP3B1 Antibody

NBP3-38363

Species: Hu, Mu, Rt

Applications: ELISA, IHC, IHC-P, WB

ATG10 Recombinant
Protein Antigen

NBP2-38524PEP

Species: Hu

Applications: AC

Publications for ATG10 Protein (NBP2-38524PEP) (0)

There are no publications for ATG10 Protein (NBP2-38524PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG10 Protein (NBP2-38524PEP) (0)

There are no reviews for ATG10 Protein (NBP2-38524PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATG10 Protein (NBP2-38524PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATG10 Products

Research Areas for ATG10 Protein (NBP2-38524PEP)

Find related products by research area.

Autophagy

Blogs on ATG10.

Check out the latest blog posts on ATG10.

Animal Models to Study Autophagy
By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the... Read full blog post.

From Then ‘till Now: The History of Autophagy and Cancer Research
By Christina Towers, PhD. The fundamental process that cells use to degrade damaged cytoplasmic material and recycle nutrients is called autophagy. This term was first coined by the Belgium biochemist Christian de... Read full blog post.

ATG12 - a ubiquitin-like protein essential for autophagosome assembly
Atg12 is a ubiquitin-like protein that plays an essential role in cellular homeostasis by regulating the degradation and recycling of cytoplasmic organelles and macromolecules. Atg12 is one of two ubiquitin-like protein systems that is required du... Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

LC3A Antibody - BSA Free
NB100-2331

ATG5 Antibody - BSA Free
NB110-53818

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our ATG10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

ATG10

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

ATG10 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

ATG10 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for ATG10 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ATG10 Protein (NBP2-38524PEP) (0)

Reviews for ATG10 Protein (NBP2-38524PEP) (0)

FAQs for ATG10 Protein (NBP2-38524PEP) (0)

Additional ATG10 Products

Research Areas for ATG10 Protein (NBP2-38524PEP)

Blogs on ATG10.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics