Home » ARFGAP3 » ARFGAP3 Proteins » ARFGAP3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ARFGAP3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ARFGAP3 Protein (NBP1-88842PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ARFGAP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARFGAP3.

Source: E. coli

Amino Acid Sequence: SKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVPPLSPPP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARFGAP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88842.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ARFGAP3 Recombinant Protein Antigen

  • ADP-ribosylation factor GTPase activating protein 1
  • ADP-ribosylation factor GTPase activating protein 3
  • ADP-ribosylation factor GTPase-activating protein 3
  • ARF GAP 3
  • ARFGAP1
  • FLJ45618

Background

ARFGAP3 is encoded by this gene is a GTPase-activating protein (GAP) that associates with the Golgi apparatus and regulates the early secretory pathway of proteins. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1 (ARF1)-bound GTP, which is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is a prerequisite for the fusion of these vesicles with target compartments. The activity of this protein is sensitive to phospholipids. Multiple transcript variants encoding different isoforms have been found for this gene. This gene was originally known as ARFGAP1, but that is now the name of a related but different gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ARF1 Antibody
NBP2-29906
Immunocytochemistry/ Immunofluorescence ARF1 Antibody
Immunohistochemistry-Paraffin ARF1 Antibody
Immunohistochemistry-Paraffin ARF1 Antibody
(2 Publications)
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Annexin A2
Antibody (1G7)
H00000302-M02
Immunocytochemistry/ Immunofluorescence Annexin A2 Antibody (1G7)
Immunocytochemistry/ Immunofluorescence Annexin A2 Antibody (1G7)
Western Blot Annexin A2 Antibody (1G7)
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
Paxillin Antibody
[Unconjugated]
AF4259
Immunocytochemistry Paxillin Antibody [Unconjugated]
Western Blot Paxillin Antibody [Unconjugated]
Simple Western Paxillin Antibody [Unconjugated]
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
ARFGAP2 Antibody
NBP1-83687
Western Blot ARFGAP2 Antibody
Western Blot ARFGAP2 Antibody
Immunohistochemistry-Paraffin ARFGAP2 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Thyroid
receptor-interacting ...
NBP1-84534
Immunohistochemistry-Paraffin Thyroid receptor-interacting protein 11 Antibody
Immunocytochemistry/ Immunofluorescence Thyroid receptor-interacting protein 11 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PAG3 Antibody
NBP2-24614
Western Blot PAG3 Antibody
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
ARF6 Antibody -
BSA Free
NBP2-41263
Immunohistochemistry ARF6 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence ARF6 Antibody - BSA Free
Western Blot ARF6 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ASAP1 Antibody
NBP2-48909
Immunohistochemistry-Paraffin ASAP1 Antibody
Knockout Validated ASAP1 Antibody
Immunohistochemistry ASAP1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
LRRK2 Antibody -
BSA Free
NB300-268
Flow Cytometry LRRK2 Antibody - BSA Free
Immunohistochemistry-Paraffin LRRK2 Antibody - BSA Free
Flow Cytometry LRRK2 Antibody - BSA Free
(1 Review)
(46 Publications)
Species: Bv, Ce, Hu, I, Mu, Pl
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
GM130/GOLGA2
Antibody - BSA Free
NBP2-53420
Flow Cytometry GM130/GOLGA2 Antibody - BSA Free
Flow Cytometry GM130/GOLGA2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GM130/GOLGA2 Antibody - BSA Free
(17 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
GIT2 Antibody
NBP2-16661
Immunohistochemistry-Frozen GIT2 Antibody
Immunocytochemistry/ Immunofluorescence GIT2 Antibody
Western Blot GIT2 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, WB
LMAN1 Antibody
(OTI1A8)
NBP2-03381
Western Blot LMAN1 Antibody (OTI1A8)
Flow Cytometry LMAN1 Antibody (OTI1A8)
Western Blot LMAN1 Antibody (OTI1A8)
(4 Publications)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AGAP1 Antibody
NBP1-31261
Western Blot AGAP1 Antibody
Western Blot AGAP1 Antibody
Western Blot AGAP1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
TMED2 Antibody
NBP1-80963
Immunohistochemistry-Paraffin TMED2 Antibody
Immunohistochemistry-Paraffin TMED2 Antibody
Immunohistochemistry-Paraffin TMED2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB

Publications for ARFGAP3 Protein (NBP1-88842PEP) (0)

There are no publications for ARFGAP3 Protein (NBP1-88842PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARFGAP3 Protein (NBP1-88842PEP) (0)

There are no reviews for ARFGAP3 Protein (NBP1-88842PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ARFGAP3 Protein (NBP1-88842PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARFGAP3 Products

Blogs on ARFGAP3

There are no specific blogs for ARFGAP3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: LRRK2 Antibody [NB300-268] - Analysis using the Alexa Fluor 647 conjugate of NB300-268. Staining of LRRK2 in normal human peripheral blood cells (anticoagulated Lithium-Heparin) using anti-LRRK2 antibody conjugated with AF647. The primary antibody was used at a dilution of 1:200 and incubated for 20 min at room temperature. Image from verified customer review.
LRRK2 Antibody - BSA Free
NB300-268

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ARFGAP3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ARFGAP3