Home » ADPRHL2 » ADPRHL2 Proteins » ADPRHL2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ADPRHL2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ADPRHL2 Recombinant Protein Antigen (NBP3-17334PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ADPRHL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADPRHL2

Source: E. coli

Amino Acid Sequence: FKKLLNPKCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHLALQGES

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADPRHL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17334.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ADPRHL2 Recombinant Protein Antigen

  • [Protein ADP-ribosylarginine] hydrolase-like protein 2
  • ADP-ribosylhydrolase 3
  • ADP-ribosylhydrolase like 2
  • ARH3EC 3.2.1.143
  • FLJ20446
  • poly(ADP-ribose) glycohydrolase ARH3
  • protein ADP-ribosylarginine hydrolase-like protein 2

Background

ADP-ribosylation is a reversible posttranslational modification used to regulate protein function. ADP-ribosyltransferases (see ART1; MIM 601625) transfer ADP-ribose from NAD+ to the target protein, and ADP-ribosylhydrolases, such as ADPRHL2, reverse the reaction (Glowacki et al., 2002 [PubMed 12070318]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PARG Antibody
(OTI6F4)
NBP2-46320
Western Blot PARG Antibody (OTI6F4)
Immunohistochemistry-Paraffin PARG Antibody (OTI6F4)
Immunohistochemistry-Paraffin PARG Antibody (OTI6F4)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ARH Antibody
(4G4-D5)
H00026119-M01
Immunocytochemistry/ Immunofluorescence ARH Antibody (4G4-D5)
Immunohistochemistry-Paraffin ARH Antibody (4G4-D5)
Sandwich ELISA ARH Antibody (4G4-D5)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
PARP Antibody
(194C1439) - Cleaved ...
NBP2-27335
Immunocytochemistry/ Immunofluorescence PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Sirtuin 1/SIRT1
Antibody (1F3) - BSA ...
NBP1-51641
Immunohistochemistry-Paraffin Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free
Flow Cytometry Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free
Immunocytochemistry/ Immunofluorescence Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free
(9 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB

ADP-ribosylarginine hy ...
H00000141-M04
Western Blot ADP-ribosylarginine hydrolase Antibody (1F11)
ELISA ADP-ribosylarginine hydrolase Antibody (1F11)
Immunohistochemistry-Paraffin ADP-ribosylarginine hydrolase Antibody (1F11)
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Sir2.1 Antibody
NB100-1923
Western Blot Sir2.1 Antibody
(1 Review)
(2 Publications)
Species: Ce
Applications: IHC, IHC-P, IP, WB
JTB Antibody
NBP1-81746
Western Blot JTB Antibody
Immunocytochemistry/ Immunofluorescence JTB Antibody
Immunohistochemistry-Paraffin JTB Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(2 Publications)
Species: Hu
Applications: DirELISA, IP, WB
Collagen XI alpha
2 Antibody (473)
NBP2-43728
Immunocytochemistry/ Immunofluorescence Collagen XI alpha 2 Antibody (473)
Western Blot Collagen XI alpha 2 Antibody (473)
Western Blot Collagen XI alpha 2 Antibody (473)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
TRPM2 Antibody -
BSA Free
NB110-81601
Immunocytochemistry/ Immunofluorescence TRPM2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TRPM2 Antibody - BSA Free
Western Blot TRPM2 Antibody - BSA Free
(13 Publications)
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Clusterin/APOJ
Antibody [Unconjugate
AF2747
Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]
Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]
Western Blot Clusterin/APOJ Antibody [Unconjugated]
(13 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
ADPRHL1 Antibody
NBP2-39073
Immunohistochemistry-Paraffin ADPRHL1 Antibody
Immunohistochemistry-Paraffin ADPRHL1 Antibody
Immunohistochemistry-Paraffin ADPRHL1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ADP-Sugar
Pyrophosphatase/NUDT5 ...
NBP1-83131
Immunocytochemistry/ Immunofluorescence ADP-Sugar Pyrophosphatase/NUDT5 Antibody
Immunohistochemistry ADP-Sugar Pyrophosphatase/NUDT5 Antibody
Immunohistochemistry-Paraffin ADP-Sugar Pyrophosphatase/NUDT5 Antibody
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
LDLR Antibody
[Unconjugated]
AF2255
Immunohistochemistry LDLR Antibody [Unconjugated]
Western Blot LDLR Antibody [Unconjugated]
Western Blot LDLR Antibody [Unconjugated]
(46 Publications)
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
MRPL52 Antibody
NBP1-86094
Immunohistochemistry-Paraffin MRPL52 Antibody
Western Blot MRPL52 Antibody
Immunocytochemistry/ Immunofluorescence MRPL52 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
LMP7/PSMB8
Antibody (1B3)
H00005696-M01
Western Blot LMP7/PSMB8 Antibody (1B3)
Immunocytochemistry/ Immunofluorescence LMP7/PSMB8 Antibody (1B3)
Immunohistochemistry-Paraffin LMP7/PSMB8 Antibody (1B3)
(3 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
TORC2 Antibody -
BSA Free
NBP2-22356
Simple Western TORC2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TORC2 Antibody - BSA Free
Western Blot TORC2 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
ST8
alpha-2,8-Sialyltrans ...
7027-GT
ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 [Unconjugated]
Species: Hu, Wf
Applications: EnzAct
FUT9 Antibody
NBP2-57960
Immunocytochemistry/ Immunofluorescence FUT9 Antibody
Species: Hu
Applications: ICC/IF
LRP-11 Antibody
AF8355
Western Blot LRP-11 Antibody
Immunohistochemistry LRP-11 Antibody
(1 Publication)
Species: Hu
Applications: IHC, WB

Publications for ADPRHL2 Recombinant Protein Antigen (NBP3-17334PEP) (0)

There are no publications for ADPRHL2 Recombinant Protein Antigen (NBP3-17334PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADPRHL2 Recombinant Protein Antigen (NBP3-17334PEP) (0)

There are no reviews for ADPRHL2 Recombinant Protein Antigen (NBP3-17334PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ADPRHL2 Recombinant Protein Antigen (NBP3-17334PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADPRHL2 Products

Research Areas for ADPRHL2 Recombinant Protein Antigen (NBP3-17334PEP)

Find related products by research area.

Blogs on ADPRHL2

There are no specific blogs for ADPRHL2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ADPRHL2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ADPRHL2