Novus Biologicals products are now on bio-techne.com

Adenylate Cyclase 8 Recombinant Protein Antigen

Images

 
There are currently no images for Adenylate Cyclase 8 Protein (NBP1-90278PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Adenylate Cyclase 8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADCY8.

Source: E. coli

Amino Acid Sequence: DRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADCY8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90278.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Adenylate Cyclase 8 Recombinant Protein Antigen

  • AC8
  • ADCY3
  • ADCY8
  • adenylate cyclase 8 (brain)
  • Adenylate Cyclase 8
  • adenylate cyclase type 8
  • Adenylate cyclase type VIII
  • Adenylyl cyclase 8
  • adenylyl cyclase-8, brain
  • ATP pyrophosphate-lyase 8
  • Ca(2+)/calmodulin-activated adenylyl cyclase
  • EC 4.6.1.1
  • HBAC1

Background

ADCY8, also known as Adenylate cyclase type 8, is a 140 kDa 1,251 amino acid protein, and is involved in the encoding of a membrane-bound enzyme that has to do with learning. This protein has also been shown to have interactions with CALM1, CALM2, CALM3, PPP2CA, and CFTR in the Signaling by FGFR, PKA activation in glucagon signaling, DAG and IP3 signaling, Regulation of Water Balance by Renal Aquaporins, and Opioid Signalling pathway. Disease research is currently being studied with relation to ADCY8 and drug dependence, bipolar disorder, cholera, and Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-12505
Species: Mu, Rb, Rt
Applications: ELISA, IP, WB
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
H00010141-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP3-12216
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP3-12233
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP3-12215
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP3-12218
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP3-12217
Species: Bv, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-92794
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-12214
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF640
Species: Mu
Applications: IHC, WB
MAB6898
Species: Hu, Mu
Applications: WB

Publications for Adenylate Cyclase 8 Protein (NBP1-90278PEP) (0)

There are no publications for Adenylate Cyclase 8 Protein (NBP1-90278PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenylate Cyclase 8 Protein (NBP1-90278PEP) (0)

There are no reviews for Adenylate Cyclase 8 Protein (NBP1-90278PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Adenylate Cyclase 8 Protein (NBP1-90278PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Adenylate Cyclase 8 Products

Research Areas for Adenylate Cyclase 8 Protein (NBP1-90278PEP)

Find related products by research area.

Blogs on Adenylate Cyclase 8

There are no specific blogs for Adenylate Cyclase 8, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Adenylate Cyclase 8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADCY8