Novus Biologicals products are now on bio-techne.com

5-HT1E Recombinant Protein Antigen

Images

 
There are currently no images for 5-HT1E Protein (NBP1-90320PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

5-HT1E Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HTR1E.

Source: E. coli

Amino Acid Sequence: RIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRER

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HTR1E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90320.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 5-HT1E Recombinant Protein Antigen

  • 5HT1E
  • 5-HT1E
  • 5-HT-1E
  • 5-hydroxytryptamine (serotonin) receptor 1E
  • HTR1E
  • S31
  • S31,5-HT1E5-hydroxytryptamine receptor 1E
  • Serotonin receptor 1E

Background

5HT1E Receptor, also known as 5-hydroxytryptamine receptor 1E, is a 365 amino acid protein that is 42 kDa, belongs to the G-protein coupled receptor 1 family, has cell membrane intracellular location; commonly found in the cortex, caudate putamen, claustrum, hippocampus, and amygdala; is one of the many different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that plays a role of a neurotransmitter, a hormone, and a mitogen; this receptor activity is mediated by G proteins that inhibit adenylate cyclase activity. The protein is being studied for its involvement in attention deficit hyperactivity disorder, autism spectrum disorder, chronic fatigue syndrome, hermaphroditism, pharyngitis, neuronitis, and skin papilloma. This protein has been linked to the GPCR downstream signaling, GPCR ligand binding, class A/1 (Rhodopsin-like receptors), serotonin receptors, amine ligand-binding receptors, intracellular calcium signaling, signal transduction, G alpha (i) signaling events, neuroactive ligand-receptor interaction, and amine ligand-binding receptors pathways where it interacts with PSMC3, PSMC4, ADORA3, ADORA1, ADRA2A, APP, CCR3 and over 100 other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21590
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-Fr, Simple Western, WB
NLS590
Species: Hu, Pm
Applications: IHC, IHC-P
MAB5764
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-78403
Species: Hu
Applications: ICC/IF, WB
NBP1-46557
Species: Mu, Rt
Applications: IHC, WB
NB100-56352
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, Simple Western, WB
NBP1-90322
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20212
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89985
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-2269
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NBP3-05567
Species: Hu, Mu
Applications: ICC/IF, WB
AF3918
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB

Publications for 5-HT1E Protein (NBP1-90320PEP) (0)

There are no publications for 5-HT1E Protein (NBP1-90320PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT1E Protein (NBP1-90320PEP) (0)

There are no reviews for 5-HT1E Protein (NBP1-90320PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for 5-HT1E Protein (NBP1-90320PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 5-HT1E Products

Research Areas for 5-HT1E Protein (NBP1-90320PEP)

Find related products by research area.

Blogs on 5-HT1E

There are no specific blogs for 5-HT1E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RPL7 Antibody
NB100-2269

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our 5-HT1E Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR1E