Novus Biologicals products are now on bio-techne.com

ZNF540 Recombinant Protein Antigen

Name: ZNF540 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-84170PEP
Price: 279 USD

Images

There are currently no images for ZNF540 Protein (NBP1-84170PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ZNF540 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF540. Source: E. coli Amino Acid Sequence: LSSEKDIHEISLSKESIIEKSKTLRLKGSIFRNEWQNKSEFEGQQGLKERSISQKKIVSKKMSTDRKRPSFTLNQRIHNSEKSCDSHLVQHGKIDSDVKHDCKECGSTFNNVYQLTLHQKIHTGEKSCKCEKCGK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	ZNF540
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84170. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZNF540 Recombinant Protein Antigen

DKFZp313K2238
DKFZp547B0714
FLJ16004
Nbla10512
putative protein product of Nbla10512
zinc finger protein 540

Background

ZNF540 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MVP Antibody

NBP1-82820

Immunohistochemistry-Paraffin MVP Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

ZNF154 Antibody

NBP3-17563

Immunocytochemistry/ Immunofluorescence ZNF154 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

FAM150A Antibody

NBP1-90646

Species: Hu

Applications: IHC, IHC-P

mGluR6 Antibody

NB300-189

(6 Publications)

Species: Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, WB

Elk-1 [p Ser389]
Antibody - BSA Free

NBP2-54759

Immunohistochemistry Elk-1 [p Ser389] Antibody - BSA Free

Species: Hu

Applications: IHC, IHC-P, WB

PCDHAC1 Antibody

NBP2-56958

Species: Hu

Applications: ICC/IF

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

PRAC Antibody -
BSA Free

NB200-142

Species: Hu

Applications: ELISA, IHC, IHC-Fr, IHC-P, WB

ZNF671 Antibody

NBP1-92641

Immunocytochemistry/ Immunofluorescence ZNF671 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

EphB2 Antibody
[Unconjugated]

AF467

Western Blot EphB2 Antibody [Unconjugated]

Immunocytochemistry EphB2 Antibody [Unconjugated]

(5 Reviews)

(62 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB

KHDRBS2 Antibody
(7G8C10) - BSA Free

NBP2-37254

Western Blot KHDRBS2 Antibody (7G8C10) - BSA Free

Species: Hu, Mu

Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB

Recombinant Human
FAM78A GST (N-Term) P ...

H00286336-P01

Species: Hu

Applications: ELISA, AP, PA, PAGE, WB

Wnt-3a
[Unconjugated]

5036-WN

(367 Publications)

Species: Hu

Applications: BA, BA

ASCL2/Mash2
Antibody [Unconjugate

AF6539

Immunohistochemistry ASCL2/Mash2 Antibody [Unconjugated]

(3 Publications)

Species: Hu

Applications: IHC, WB

nkx6.2 Antibody

NBP3-09184

Species: Hu

Applications: WB

Kv7.1 Antibody
(S37A/10)

NBP2-12897

Species: Ha, Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB

SLC13A5 Antibody

NBP1-92394

Species: Hu

Applications: IHC, IHC-P, WB

Thyrotropin
Releasing Hormone Ant

NBP2-34014

Species: Hu

Applications: IHC, IHC-P

RIMS4 Antibody

NBP2-31842

Species: Hu

Applications: ICC/IF

ZNF540 Recombinant
Protein Antigen

NBP1-84170PEP

Species: Hu

Applications: AC

Publications for ZNF540 Protein (NBP1-84170PEP) (0)

There are no publications for ZNF540 Protein (NBP1-84170PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF540 Protein (NBP1-84170PEP) (0)

There are no reviews for ZNF540 Protein (NBP1-84170PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZNF540 Protein (NBP1-84170PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF540 Products

Blogs on ZNF540

There are no specific blogs for ZNF540, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.

EphB2 Antibody [Unconjugated]
AF467

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our ZNF540 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

ZNF540

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

ZNF540 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

ZNF540 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for ZNF540 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ZNF540 Protein (NBP1-84170PEP) (0)

Reviews for ZNF540 Protein (NBP1-84170PEP) (0)

FAQs for ZNF540 Protein (NBP1-84170PEP) (0)

Additional ZNF540 Products

Blogs on ZNF540

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics