Home » TUSC2 » TUSC2 Proteins » TUSC2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TUSC2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TUSC2 Protein (NBP1-86794PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TUSC2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TUSC2.

Source: E. coli

Amino Acid Sequence: SGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TUSC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86794.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TUSC2 Recombinant Protein Antigen

  • C3orf11PDAP2
  • Fus-1 protein
  • FUS1Fusion 1 protein
  • LGCC
  • PAP
  • PDGFA associated protein 2
  • PDGFA-associated protein 2
  • tumor suppressor candidate 2

Background

TUSC2 is a gene that codes for a protein that is 110 amino acids long and weighs approximately 12 kDa and that functions as a tumor suppressor, which inhibits colony formation and causes G1 arrest to ultimately induce apoptosis. Current research is being done on diseases and disorders related to this gene including lung cancer, soft tissue sarcoma, carcinoid syndrome, NSCLC, and breast cancer. TUSC2 has also been shown to have interactions with HSPA4L, LRBA, EBLN2, GK006, and SGOL2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB

Puromycin-sensitive am ...
NBP2-13669
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PSAT1 Antibody
NBP1-32920
Western Blot PSAT1 Antibody
Immunocytochemistry/ Immunofluorescence PSAT1 Antibody
Immunohistochemistry-Paraffin PSAT1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western Blot Protein S/PROS1 Antibody [Unconjugated]
Simple Western Protein S/PROS1 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: Simple Western, WB
PLAG1 Antibody
(3B7)
H00005324-M02
Immunohistochemistry PLAG1 Antibody (3B7)
Immunohistochemistry PLAG1 Antibody (3B7)
ELISA PLAG1 Antibody (3B7)
(20 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
PDXP Antibody -
Azide and BSA Free
NBP2-93574
Western Blot PDXP Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence PDXP Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin PDXP Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CD155/PVR Antibody
(300907) [Unconjugate ...
MAB25301
Flow Cytometry CD155/PVR Antibody (300907) [Unconjugated]
Flow Cytometry CD155/PVR Antibody (300907) [Unconjugated]
Immunocytochemistry CD155/PVR Antibody (300907) [Unconjugated]
(1 Review)
(9 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
PMEL17/SILV
Antibody (HMB45)
NBP2-44520
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Immunohistochemistry PMEL17/SILV Antibody (HMB45)
(8 Publications)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin NDUFB6 Antibody
Western Blot NDUFB6 Antibody
Immunocytochemistry/ Immunofluorescence NDUFB6 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Prothrombin
Antibody
NBP1-58268
Immunohistochemistry-Paraffin Prothrombin Antibody
Immunohistochemistry-Paraffin Prothrombin Antibody
Western Blot Prothrombin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
ATAT1 Antibody
NBP2-48990
Immunocytochemistry/ Immunofluorescence ATAT1 Antibody
Immunohistochemistry-Paraffin ATAT1 Antibody
Immunohistochemistry-Paraffin ATAT1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TAT Antibody
NBP1-79286
Western Blot TAT Antibody
(1 Review)
Species: Rt
Applications: WB
PAPD1 Antibody
(1D3)
NBP2-43686
Western Blot PAPD1 Antibody (1D3)
Immunocytochemistry/ Immunofluorescence PAPD1 Antibody (1D3)
Immunohistochemistry-Paraffin PAPD1 Antibody (1D3)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Serpin E1/PAI-1
Antibody - BSA Free
NBP1-19773
Western Blot Serpin E1/PAI-1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Serpin E1/PAI-1 Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin E1/PAI-1 Antibody - BSA Free
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
CEACAM5/CD66e
Antibody (CEA31) - Az ...
NBP2-34594
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
(2 Reviews)
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
CEACAM7 Antibody
[Unconjugated]
AF4478
Immunohistochemistry CEACAM7 Antibody [Unconjugated]
Western Blot CEACAM7 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
PSG2 Antibody
NBP3-41306
PSG2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
t-Plasminogen
Activator/tPA [HRP]
DTPA00
N/A t-Plasminogen Activator/tPA [HRP]
N/A t-Plasminogen Activator/tPA [HRP]
(7 Publications)
Species: Hu
Applications: ELISA

Publications for TUSC2 Protein (NBP1-86794PEP) (0)

There are no publications for TUSC2 Protein (NBP1-86794PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TUSC2 Protein (NBP1-86794PEP) (0)

There are no reviews for TUSC2 Protein (NBP1-86794PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TUSC2 Protein (NBP1-86794PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TUSC2 Products

Research Areas for TUSC2 Protein (NBP1-86794PEP)

Find related products by research area.

Blogs on TUSC2

There are no specific blogs for TUSC2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: Serpin E1/PAI-1 Antibody [NBP1-19773] - Extracts from Jurkat cells.
Serpin E1/PAI-1 Antibody - BSA Free
NBP1-19773

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TUSC2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TUSC2