![Western Blot: TOM1 Antibody (1C5) [H00010043-M06] - Analysis of TOM1 expression in HeLa (Cat # L013V1).](http://images.novusbio.com/fullsize/TOM1-Antibody-1C5-Western-Blot-H00010043-M06-img0004.jpg "Western Blot: TOM1 Antibody (1C5) [H00010043-M06] - Analysis of TOM1 expression in HeLa (Cat # L013V1).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 1C5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | TOM1 (NP_005479, 394 a.a. ~ 491 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFA |
| Specificity | TOM1 - target of myb1 (chicken) (1C5) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TOM1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: TOM1 Antibody (1C5) [H00010043-M06] - detection against Immunogen (36.89 KDa) .](http://images.novusbio.com/fullsize/TOM1-Antibody-1C5-Western-Blot-H00010043-M06-img0003.jpg "Western Blot: TOM1 Antibody (1C5) [H00010043-M06] - detection against Immunogen (36.89 KDa) .")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")