Home » TCP1-eta » TCP1-eta Proteins » TCP1-eta Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TCP1-eta Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TCP1-eta Protein (NBP1-88144PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TCP1-eta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCT7.

Source: E. coli

Amino Acid Sequence: ELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCT7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88144.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TCP1-eta Recombinant Protein Antigen

  • CCTETA
  • CCT-eta
  • CCTH
  • chaperonin containing TCP1, subunit 7 (eta)
  • eta subunit
  • HIV-1 Nef interacting protein
  • HIV-1 Nef-interacting protein
  • MGC110985
  • Nip7-1
  • T-complex protein 1 subunit eta

Background

TCP1-eta encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants encoding different isoforms have been found for this gene, but only two of them have been characterized to date.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TCP1-beta Antibody
NBP1-88146
Immunocytochemistry/ Immunofluorescence TCP1-beta Antibody
Immunohistochemistry-Paraffin TCP1-beta Antibody
Immunohistochemistry-Paraffin TCP1-beta Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
TCP1 alpha
Antibody (2B2-D6)
H00006950-M01
Immunocytochemistry/ Immunofluorescence TCP1 alpha Antibody (2B2-D6)
Immunohistochemistry-Paraffin TCP1 alpha Antibody (2B2-D6)
Western Blot TCP1 alpha Antibody (2B2-D6)
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PCYT1B Antibody
H00009468-D01P
Western Blot PCYT1B Antibody
Western Blot PCYT1B Antibody
Western Blot PCYT1B Antibody
Species: Hu
Applications: WB
CCT5 Antibody
NBP1-83042
Immunocytochemistry/ Immunofluorescence CCT5 Antibody
Immunohistochemistry-Paraffin CCT5 Antibody
Immunohistochemistry-Paraffin CCT5 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PDCL Antibody
NBP1-32523
Immunohistochemistry-Paraffin PDCL Antibody
Immunohistochemistry-Paraffin PDCL Antibody
Immunocytochemistry/ Immunofluorescence PDCL Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
HSP60 Antibody -
BSA Free
NBP1-77397
Immunocytochemistry/ Immunofluorescence HSP60 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence HSP60 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence HSP60 Antibody - BSA Free
(4 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
CCT3 Antibody
NBP1-86562
Immunohistochemistry-Paraffin CCT3 Antibody
Immunocytochemistry/ Immunofluorescence CCT3 Antibody
Western Blot CCT3 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
PCYT1A Antibody
NBP1-84366
Immunocytochemistry/ Immunofluorescence PCYT1A Antibody
Western Blot PCYT1A Antibody
Immunohistochemistry-Paraffin PCYT1A Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TCP1-delta Antibody
NBP1-88145
Immunocytochemistry/ Immunofluorescence TCP1-delta Antibody
Immunohistochemistry-Paraffin TCP1-delta Antibody
Immunohistochemistry-Paraffin TCP1-delta Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CCT6A Antibody
NBP2-46715
Immunohistochemistry-Paraffin CCT6A Antibody
Western Blot CCT6A Antibody
Western Blot CCT6A Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
CCT8 Antibody
NBP1-88285
Immunocytochemistry/ Immunofluorescence CCT8 Antibody
Immunohistochemistry-Paraffin CCT8 Antibody
Western Blot CCT8 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Phosducin Antibody
- BSA Free
NBP2-94660
Immunohistochemistry-Paraffin Phosducin Antibody - BSA Free
Western Blot Phosducin Antibody - BSA Free
Immunohistochemistry-Paraffin Phosducin Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Recombinant Human
GPSM3 GST (N-Term) Pr ...
H00063940-P01
Other Recombinant Human GPSM3 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(795 Publications)
Species: Hu
Applications: BA
TCP1-eta
Recombinant Protein A
NBP1-88144PEP
TCP1-eta Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for TCP1-eta Protein (NBP1-88144PEP) (0)

There are no publications for TCP1-eta Protein (NBP1-88144PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCP1-eta Protein (NBP1-88144PEP) (0)

There are no reviews for TCP1-eta Protein (NBP1-88144PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TCP1-eta Protein (NBP1-88144PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TCP1-eta Products

Research Areas for TCP1-eta Protein (NBP1-88144PEP)

Find related products by research area.

Blogs on TCP1-eta

There are no specific blogs for TCP1-eta, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TCP1-eta Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CCT7