SLC44A2 Antibody (3D11) Summary
Immunogen |
CTL2 (AAH40556, 123 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTV |
Specificity |
SLC44A2 - CTL2 protein |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
SLC44A2 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
Application Notes |
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SLC44A2 Antibody (3D11)
Background
SLC44A2, also known as Choline transporter-like protein 2, is a 80kDa 706 amino acid protein with a short 704 isoform approximately 80kDa and a longer 711 isoform approximately 81kDa. Isoform 1 may function as a choline transporter. Research is currently being conducted on SLC44A2 in relation tocarcinoma, leukemia, colon carcinoma and chronic lymphocytic leukemia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Publications for SLC44A2 Antibody (H00057153-M01)(5)
Showing Publications 1 -
5 of 5.
Publications using H00057153-M01 |
Applications |
Species |
Nishiyama R, Nagashima F, Iwao B et al. Identification and functional analysis of choline transporter in tongue cancer: A novel molecular target for tongue cancer therapy. Journal of Pharmacological Sciences 2016-05-01 [PMID: 27262903] |
|
|
Iwao B, Yara M, Hara N et al. Functional expression of choline transporter like-protein 1 (CTL1) and CTL2 in human brain microvascular endothelial cells. Neurochem Int 2015-12-31 [PMID: 26746385] |
|
|
Taguchi C, Inazu M, Saiki I et al. Functional analysis of [methyl-3H]choline uptake in glioblastoma cells: influence of anti-cancer and central nervous system drugs. Biochem Pharmacol. 2014-02-12 [PMID: 24530235] |
|
|
Bayat B, Tjahjono Y, Sydykov A et al. Anti-human neutrophil antigen-3a induced transfusion-related acute lung injury in mice by direct disturbance of lung endothelial cells. Arterioscler Thromb Vasc Biol. 2013-09-05 [PMID: 24008160] |
|
|
Yabuki M, Inazu M, Yamada T et al. Molecular functional characterization of choline transporter in rat renal tubule epithelial NRK-52E cells. Arch Biochem Biophys 485(1):88-96. 2009-05-01 [PMID: 19236841] |
|
|
Reviews for SLC44A2 Antibody (H00057153-M01) (0)
There are no reviews for SLC44A2 Antibody (H00057153-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SLC44A2 Antibody (H00057153-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SLC44A2 Products
Research Areas for SLC44A2 Antibody (H00057153-M01)
Find related products by research area.
|
Blogs on SLC44A2