Novus Biologicals products are now on bio-techne.com

RNF139 Recombinant Protein Antigen

Images

 
There are currently no images for RNF139 Protein (NBP1-83212PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RNF139 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RNF139.

Source: E. coli

Amino Acid Sequence: PEIKGSRLQEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RNF139
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83212.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RNF139 Recombinant Protein Antigen

  • EC 6.3.2.-
  • HRCA1
  • patched related protein translocated in renal cancer
  • RCA1multiple membrane spanning receptor TRC8
  • ring finger protein 139MGC31961
  • Translocation in renal carcinoma on chromosome 8 protein
  • TRC8E3 ubiquitin-protein ligase RNF139

Background

RNF139 is encoded by this gene is a multi-membrane spanning protein containing a RING-H2 finger. This protein is located in the endoplasmic reticulum, and has been shown to possess ubiquitin ligase activity. This gene was found to be interrupted by a t(3:8) translocation in a family with hereditary renal and non-medulary thyroid cancer. Studies of the Drosophila counterpart suggested that this protein may interact with tumor suppressor protein VHL, as well as with COPS5/JAB1, a protein responsible for the degradation of tumor suppressor CDKN1B/P27KIP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-35882
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB120-495
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-89062
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF4885
Species: Mu
Applications: IP, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP3-35268
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-87431
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB

Publications for RNF139 Protein (NBP1-83212PEP) (0)

There are no publications for RNF139 Protein (NBP1-83212PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF139 Protein (NBP1-83212PEP) (0)

There are no reviews for RNF139 Protein (NBP1-83212PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RNF139 Protein (NBP1-83212PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF139 Products

Research Areas for RNF139 Protein (NBP1-83212PEP)

Find related products by research area.

Blogs on RNF139

There are no specific blogs for RNF139, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RNF139 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF139