![Western Blot: PIGQ Antibody (2B7) [H00009091-M02] - Analysis of PIGQ expression in transfected 293T cell line by PIGQ monoclonal antibody (M02), clone 2B7.Lane 1: PIGQ transfected lysate(84.1 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PIGQ-Antibody-2B7-Western-Blot-H00009091-M02-img0005.jpg "Western Blot: PIGQ Antibody (2B7) [H00009091-M02] - Analysis of PIGQ expression in transfected 293T cell line by PIGQ monoclonal antibody (M02), clone 2B7.Lane 1: PIGQ transfected lysate(84.1 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 2B7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | PIGQ (NP_683721.1, 661 a.a. ~ 758 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HCPMPTLCTQVQRVRPPQQPQVEGWSPWGLPSGSALAVGVEGPCQDEPPSPRHPLAPSAEQHPASGGLKQSLTPVPSGPGPSLPEPHGVYLRMFPGEV |
| Specificity | PIGQ - phosphatidylinositol glycan, class Q (2B7) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PIGQ |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: PIGQ Antibody (2B7) [H00009091-M02] - Analysis of monoclonal antibody to PIGQ on formalin-fixed paraffin-embedded human placenta. Antibody concentration 4 ug/ml.](http://images.novusbio.com/fullsize/PIGQ-Antibody-2B7-Immunohistochemistry-Paraffin-H00009091-M02-img0003.jpg "Immunohistochemistry-Paraffin: PIGQ Antibody (2B7) [H00009091-M02] - Analysis of monoclonal antibody to PIGQ on formalin-fixed paraffin-embedded human placenta. Antibody concentration 4 ug/ml.")
![Sandwich ELISA: PIGQ Antibody (2B7) [H00009091-M02] - Detection limit for recombinant GST tagged PIGQ is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/PIGQ-Antibody-2B7-Sandwich-ELISA-H00009091-M02-img0004.jpg "Sandwich ELISA: PIGQ Antibody (2B7) [H00009091-M02] - Detection limit for recombinant GST tagged PIGQ is approximately 0.1ng/ml as a capture antibody.")
