Home » NSUN2 » NSUN2 Proteins » NSUN2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NSUN2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NSUN2 Protein (NBP1-82189PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NSUN2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NSUN2.

Source: E. coli

Amino Acid Sequence: PFVFIPEDDPLFPPIEKFYALDPSFPRMNLLTRTTEGKKRQLYMVSKELRNVLLNNSEKMKVINTGIKVWCRNNSGEEFDCAFRLAQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NSUN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82189.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NSUN2 Recombinant Protein Antigen

  • EC 2.1.1
  • EC 2.1.1.29
  • FLJ20303,5-methycytoisine methyltransferase
  • hTrm4
  • member 2
  • Myc-induced SUN-domain-containing protein
  • NOL1/NOP2/Sun domain family 2
  • NOL1/NOP2/Sun domain family member 2
  • NOP2/Sun domain family, member 2
  • SAKIMisu
  • Substrate of AIM1/Aurora kinase B
  • TRM4MISU
  • tRNA (cytosine-5-)-methyltransferase NSUN2
  • tRNA (cytosine-5-)-methyltransferase
  • tRNA methyltransferase 4 homolog

Background

Maturation of cytoplasmic tRNAs includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing tRNA genes. In tRNA-leu(CAA), the first position of the anticodon, C34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. NSUN2 encodes a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at C34 of tRNA-leu(CAA) (Brzezicha et al., 2006 [PubMed 17071714]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Calpain 3 Antibody
NBP3-35199
Western Blot Calpain 3 Antibody
Immunocytochemistry/ Immunofluorescence Calpain 3 Antibody
Species: Mu, Rt
Applications: ELISA, ICC/IF, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Dnmt2 Antibody
(102B1259.2)
NB200-587
Western Blot Dnmt2 Antibody (102B1259.2)
Flow Cytometry Dnmt2 Antibody (102B1259.2)
(1 Review)
(2 Publications)
Species: Hu, Mu, Ze
Applications: Flow, WB
Teashirt homolog 1
Antibody
NBP1-87377
Immunohistochemistry-Paraffin Teashirt homolog 1 Antibody
Western Blot Teashirt homolog 1 Antibody
Immunocytochemistry/ Immunofluorescence Teashirt homolog 1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Aurora B Antibody
- BSA Free
NB100-294
Immunocytochemistry/ Immunofluorescence Aurora B Antibody - BSA Free
Western Blot Aurora B Antibody - BSA Free
(5 Reviews)
(12 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
LEF1 Antibody (3H5)
H00051176-M01
Western Blot LEF1 Antibody (3H5)
Sandwich ELISA LEF1 Antibody (3H5)
Western Blot LEF1 Antibody (3H5)
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
NPM1 Antibody -
BSA Free
NB110-61646
Immunocytochemistry/ Immunofluorescence NPM1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence NPM1 Antibody - BSA Free
Western Blot NPM1 Antibody - BSA Free
(2 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NUSAP1 Antibody
H00051203-B01P
Western Blot NUSAP1 Antibody
Western Blot NUSAP1 Antibody
Western Blot NUSAP1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
Ret Antibody
[Unconjugated]
AF482
Immunohistochemistry Ret Antibody [Unconjugated]
Western Blot Ret Antibody [Unconjugated]
Immunohistochemistry Ret Antibody [Unconjugated]
(40 Publications)
Species: Mu
Applications: IHC, WB
CCDC6 Antibody
NBP1-85351
Immunohistochemistry-Paraffin CCDC6 Antibody
Immunohistochemistry-Paraffin CCDC6 Antibody
Immunohistochemistry-Paraffin CCDC6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TAS2R38 Antibody
NBP3-41370
Immunohistochemistry-Paraffin TAS2R38 Antibody
Species: Hu, Po
Applications: ICC/IF, IHC, WB
Patched 1/PTCH
Antibody (413220) [Un ...
MAB41051
Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
(10 Publications)
Species: Hu, Mu
Applications: IHC, WB
NT-proBNP Antibody
(OTI11G4)
NBP2-46201
Western Blot NT-proBNP Antibody (OTI11G4)
Immunohistochemistry NT-proBNP Antibody (OTI11G4)
Immunohistochemistry NT-proBNP Antibody (OTI11G4)
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(11 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
AUF1 Antibody
NBP3-35586
Immunohistochemistry AUF1 Antibody
Immunocytochemistry/ Immunofluorescence AUF1 Antibody
Immunoprecipitation AUF1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
SULT1A3
5829-ST
SULT1A3
(1 Publication)
Species: Hu
Applications: EnzAct
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Nucleolin Antibody
NB600-241
Immunocytochemistry/ Immunofluorescence Nucleolin Antibody
Immunocytochemistry/ Immunofluorescence Nucleolin Antibody
Western Blot Nucleolin Antibody
(2 Reviews)
(26 Publications)
Species: Hu, Mu, Pl, Rt
Applications: ChIP, ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IM, KD, Simple Western, WB

Publications for NSUN2 Protein (NBP1-82189PEP) (0)

There are no publications for NSUN2 Protein (NBP1-82189PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSUN2 Protein (NBP1-82189PEP) (0)

There are no reviews for NSUN2 Protein (NBP1-82189PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NSUN2 Protein (NBP1-82189PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NSUN2 Products

Blogs on NSUN2

There are no specific blogs for NSUN2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
p19ARF/CDKN2A Antibody - BSA Free
NB200-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NSUN2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NSUN2