Novus Biologicals products are now on bio-techne.com

Nicotinic Acetylcholine R alpha 3/CHRNA3 Recombinant Protein Antigen

Images

 
There are currently no images for Nicotinic Acetylcholine R alpha 3/CHRNA3 Protein (NBP1-87534PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Nicotinic Acetylcholine R alpha 3/CHRNA3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHRNA3.

Source: E. coli

Amino Acid Sequence: RTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHRNA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87534.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nicotinic Acetylcholine R alpha 3/CHRNA3 Recombinant Protein Antigen

  • cholinergic receptor, nicotinic, alpha 3
  • cholinergic receptor, nicotinic, alpha polypeptide 3
  • CHRNA3
  • LNCR2
  • MGC104879
  • NACHRA3
  • neuronal acetylcholine receptor subunit alpha-3
  • neuronal nicotinic acetylcholine receptor, alpha3 subunit
  • Nicotinic Acetylcholine R alpha 3
  • Nicotinic Acetylcholine Ra3
  • PAOD2

Background

The nicotinic acetylcholine receptor (nAChR) is a ligand gated ion channel that mediates neurotransmission at the neuromuscular junction, autonomic ganglia and at some sites in the central nervous system. Distinct nAChR subtypes exist that can be stimulated by the neurotransmitter acetylcholine, the natural product nicotine, or by synthetic compounds. After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 responds by an extensive change in conformation that affects all subunits and leads to opening of an ion conducting channel across the plasma membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61677
Species: Hu, Rt
Applications: ELISA, Flow, WB
NBP2-61743
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-61674
Species: Hu
Applications: ELISA, WB
NB100-1798
Species: Hu, Mu
Applications: GS, GS, ICC/IF, IHC, IHC-P, WB
NBP2-01437
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-81070
Species: Hu, Mu, Rt
Applications: B/N, ELISA, ICC/IF, WB
NBP1-28467
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
H00009455-B01P
Species: Hu, Mu, Rt
Applications: WB
H00001142-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-01608
Species: Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF1568
Species: Mu
Applications: WB
NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-23927
Species: Hu
Applications: IHC-P
NBP2-61679
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-52375
Species: Bv, Ca, Ch, Eq, Hu, Pm, Po
Applications: IHC, IHC-P, PEP-ELISA, WB
H00010312-M01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB

Publications for Nicotinic Acetylcholine R alpha 3/CHRNA3 Protein (NBP1-87534PEP) (0)

There are no publications for Nicotinic Acetylcholine R alpha 3/CHRNA3 Protein (NBP1-87534PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine R alpha 3/CHRNA3 Protein (NBP1-87534PEP) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 3/CHRNA3 Protein (NBP1-87534PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nicotinic Acetylcholine R alpha 3/CHRNA3 Protein (NBP1-87534PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Additional Nicotinic Acetylcholine R alpha 3/CHRNA3 Products

Research Areas for Nicotinic Acetylcholine R alpha 3/CHRNA3 Protein (NBP1-87534PEP)

Find related products by research area.

Blogs on Nicotinic Acetylcholine R alpha 3/CHRNA3

There are no specific blogs for Nicotinic Acetylcholine R alpha 3/CHRNA3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nicotinic Acetylcholine R alpha 3/CHRNA3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNA3