Novus Biologicals products are now on bio-techne.com

MRP1 Recombinant Protein Antigen

Images

 
There are currently no images for MRP1 Recombinant Protein Antigen (NBP3-05508PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MRP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRP1.

Source: E. coli

Amino Acid Sequence: LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-05508.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MRP1 Recombinant Protein Antigen

  • ABC29
  • ABCC
  • ABCC1
  • ATP-binding cassette sub-family C member 1
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 1
  • EC 3.6.3
  • EC 3.6.3.44
  • GS-X
  • Leukotriene C(4) transporter
  • LTC4 transporter
  • MRP1
  • MRP1DKFZp781G125
  • MRPDKFZp686N04233
  • multidrug resistance associated protein 1
  • multidrug resistance protein
  • multidrug resistance-associated protein 1
  • multiple drug resistance protein 1
  • multiple drug resistance-associated protein

Background

Multidrug Resistance Protein 1 (MRP1) is an integral membrane glycophosphoprotein belonging to the same superfamily of ATP-binding cassette transmembrane transporter proteins as P-glycoprotein. MRP1 is overexpressed in many P-glycoprotein-negative, multidrug resistant cell lines and tumours. It is believed that the main function of MRP in drug resistance is that of a plasma membrane drug efflux pump.

Specifically, MRP1 mediates the export of organic anions and drugs from the cytoplasm. It is through this function, that MRP1 is able to confer resistance to anticancer drugs. MRP1 antibodies are therefore useful tools for cancer testing and research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-69023
Species: Mu
Applications: WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82820
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
AF6278
Species: Hu, Mu
Applications: WB
NBP2-46467
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-64808
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NBP3-14454
Species: Hu
Applications: IHC, IHC-P
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP3-24587
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-42342
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for MRP1 Recombinant Protein Antigen (NBP3-05508PEP) (0)

There are no publications for MRP1 Recombinant Protein Antigen (NBP3-05508PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRP1 Recombinant Protein Antigen (NBP3-05508PEP) (0)

There are no reviews for MRP1 Recombinant Protein Antigen (NBP3-05508PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MRP1 Recombinant Protein Antigen (NBP3-05508PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRP1 Products

Research Areas for MRP1 Recombinant Protein Antigen (NBP3-05508PEP)

Find related products by research area.

Blogs on MRP1.

ABC Membrane transporters and the role of MRP1 in drug resistance
ATP-binding cassette (ABC) transporters, alongside ion channels and aquaporins, are ubiquitous membrane-bound proteins that move substrates across extra and intra cellular membranes.  Multidrug resistance-associated protein 1 (MRP1) is a member o...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Bcl-2 Antibody
NB100-56098

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MRP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC1