![Western Blot: Mesp1 Antibody (4B4) [H00055897-M09] - Analysis of MESP1 expression in COLO 320 HSR (Cat # L020V1).](http://images.novusbio.com/fullsize/Mesp1-Antibody-4B4-Western-Blot-H00055897-M09-img0002.jpg "Western Blot: Mesp1 Antibody (4B4) [H00055897-M09] - Analysis of MESP1 expression in COLO 320 HSR (Cat # L020V1).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 4B4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | MESP1 (NP_061140.1, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRD |
| Specificity | MESP1 (4B4) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MESP1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Mesp1 Antibody (H00055897-M09)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
