Novus Biologicals products are now on bio-techne.com

MBD1 Recombinant Protein Antigen

Images

 
There are currently no images for MBD1 Recombinant Protein Antigen (NBP2-68876PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

MBD1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MBD1.

Source: E. coli

Amino Acid Sequence: PGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MBD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68876.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MBD1 Recombinant Protein Antigen

  • CXXC-type zinc finger protein 3
  • methyl-CpG binding domain protein 1 isoform PCM1
  • methyl-CpG binding domain protein 1
  • methyl-CpG-binding domain protein 1
  • Methyl-CpG-binding protein MBD1
  • PCM1CXXC3RFT
  • Protein containing methyl-CpG-binding domain 1
  • the regulator of fibroblast growth factor 2 (FGF-2) transcription

Background

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56326
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-55415
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP3-16718
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-91189
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, WB (-)
NBP3-27690
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
233-FB
Species: Hu
Applications: BA
NBP1-86248
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NB120-13888
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, CyTOF-ready, Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, KD, KO, WB

Publications for MBD1 Recombinant Protein Antigen (NBP2-68876PEP) (0)

There are no publications for MBD1 Recombinant Protein Antigen (NBP2-68876PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBD1 Recombinant Protein Antigen (NBP2-68876PEP) (0)

There are no reviews for MBD1 Recombinant Protein Antigen (NBP2-68876PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MBD1 Recombinant Protein Antigen (NBP2-68876PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MBD1 Products

Array NBP2-68876PEP

Research Areas for MBD1 Recombinant Protein Antigen (NBP2-68876PEP)

Find related products by research area.

Blogs on MBD1

There are no specific blogs for MBD1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MBD1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MBD1