Home » LMBR1 » LMBR1 Proteins » LMBR1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

LMBR1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for LMBR1 Protein (NBP1-89276PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

LMBR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LMBR1.

Source: E. coli

Amino Acid Sequence: FTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LMBR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89276.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LMBR1 Recombinant Protein Antigen

  • ACHP
  • ACHPchromosome 7 open reading frame 2
  • C7orf2
  • C7orf2FLJ11665
  • DIF14
  • Differentiation-related gene 14 protein
  • limb region 1 homolog (mouse)
  • limb region 1 protein homolog
  • LMBR1
  • PPD2
  • THYP
  • TPT
  • ZRS

Background

LMBR1, also known as Limb region 1 protein homolog, has 3 isoforms, a 490 amino acid isoform 1 that is 55 kDa, a 228 amino acid isoform 2 that is 26 kDa and a 531 amino acid isoform that is 60 kDa; widely expressed in heart and pancreas; is a putative membrane receptor. Current research is being performed on several diseases and disorders including triphalangeal thumb-polysyndactyly syndrome, triphalangeal thumb, triphalangeal thumb type I, polydactyly, preaxial type ii, acheiropody, polydactyly, syndactyly, tuberculosis, cblf, acropectoral syndrome, congenital amputation, and syndactyly type 4. This protein is involved with the embryonic digit morphogenesis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(70 Publications)
Species: Mu
Applications: BA
DBT Antibody
NBP1-89522
Immunocytochemistry/ Immunofluorescence DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Proteinase
3/Myeloblastin/PRTN3 ...
NBP1-25966
Western Blot Proteinase 3/Myeloblastin/PRTN3 Antibody
Immunocytochemistry/ Immunofluorescence Proteinase 3/Myeloblastin/PRTN3 Antibody
Immunocytochemistry/ Immunofluorescence Proteinase 3/Myeloblastin/PRTN3 Antibody
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Prothrombin
Antibody
NBP1-58268
Immunohistochemistry-Paraffin Prothrombin Antibody
Immunohistochemistry-Paraffin Prothrombin Antibody
Western Blot Prothrombin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Dehydrodolichyl
Diphosphate Synthase ...
NBP1-87964
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
CHPT1 Antibody -
Azide and BSA Free
NBP2-92299
Western Blot CHPT1 Antibody - Azide and BSA Free
(1 Review)
Species: Hu
Applications: WB
ABCG2/CD338
Antibody (3G8) - BSA
NBP2-22124
ELISA ABCG2/CD338 Antibody (3G8) - BSA Free
Flow Cytometry ABCG2/CD338 Antibody (3G8) - BSA Free
Immunocytochemistry/ Immunofluorescence ABCG2/CD338 Antibody (3G8) - BSA Free
(8 Publications)
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Dermatopontin
Antibody
AF4629
Western Blot Dermatopontin Antibody
(1 Publication)
Species: Hu
Applications: WB
Siglec-1/CD169
Antibody (HSn 7D2) - ...
NB600-534
Immunohistochemistry-Frozen Siglec-1/CD169 Antibody (HSn 7D2) - BSA Free
Immunohistochemistry-Paraffin Siglec-1/CD169 Antibody (HSn 7D2) - BSA Free
Flow Cytometry Siglec-1/CD169 Antibody (HSn 7D2) - BSA Free
(1 Review)
(25 Publications)
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo, RIA, WB
Chromogranin C
Antibody
NBP2-15895
Immunohistochemistry-Paraffin Chromogranin C Antibody
Western Blot Chromogranin C Antibody
Western Blot Chromogranin C Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
POMT1 Antibody
NBP3-12487
Immunohistochemistry-Paraffin POMT1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Dystonin Antibody
NBP1-89946
Immunocytochemistry/ Immunofluorescence Dystonin Antibody
Immunohistochemistry-Paraffin Dystonin Antibody
Immunohistochemistry-Paraffin Dystonin Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TRP2 Antibody
NBP1-86893
Immunohistochemistry-Paraffin TRP2 Antibody
Immunohistochemistry-Paraffin TRP2 Antibody
Western Blot TRP2 Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
PARP Antibody
(194C1439) - Cleaved ...
NBP2-27335
Immunocytochemistry/ Immunofluorescence PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA

Publications for LMBR1 Protein (NBP1-89276PEP) (0)

There are no publications for LMBR1 Protein (NBP1-89276PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMBR1 Protein (NBP1-89276PEP) (0)

There are no reviews for LMBR1 Protein (NBP1-89276PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LMBR1 Protein (NBP1-89276PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LMBR1 Products

Blogs on LMBR1

There are no specific blogs for LMBR1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LMBR1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LMBR1