Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ELISA, ICC/IF, IHC |
Clone | 3D9 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | LHX6 (NP_055183, 274 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY |
Specificity | LHX6 (3D9) |
Isotype | IgG2b Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | LHX6 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. Use in Immunohistochemistry-frozen and Immunocytochemistry/Immunofluorescence reported in scientific literature (PMID:19906869). |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | Protein A purified |
Publication using H00026468-M01 | Applications | Species |
---|---|---|
Jacquet BV, Salinas-Mondragon R, Liang H et al. FoxJ1-dependent gene expression is required for differentiation of radial glia into ependymal cells and a subset of astrocytes in the postnatal brain. Development 2009-12-01 [PMID: 19906869] (IHC-Fr, ICC/IF, Mouse) | IHC-Fr, ICC/IF | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.