Novus Biologicals products are now on bio-techne.com

IFIT3 Recombinant Protein Antigen

Name: IFIT3 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-32500PEP
Price: 279 USD

Images

There are currently no images for IFIT3 Protein (NBP2-32500PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

IFIT3 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IFIT3. Source: E. coli Amino Acid Sequence: HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	IFIT3
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32500. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IFIT3 Recombinant Protein Antigen

CIG-49
GARG-49
IFI60Retinoic acid-induced gene G protein
IFIT-3
IFIT-4
IFIT4IFI-60K
interferon-induced protein with tetratricopeptide repeats 3
Interferon-induced protein with tetratricopeptide repeats 4Interferon-induced 60 kDa protein
IRG2
ISG60
ISG-60
RIG-GCIG49

Background

IFIT3, also known as IFIT4, IFI60, and RIGG, has been identified as a key element in the IFN-alpha anti-viral pathway. Additionally, IFIT3 binding negatively regulates the apoptotic effects of ISG54. IFIT3 is also a key target of STAT1, which is important in regulating IFN responses. One study has shown that expression of RIGG in a human monocytoma line led to growth arrest at the G1/S transition.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(809 Publications)

Species: Hu

Applications: BA

SUB1 Antibody

NBP1-82454

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

Src [p Tyr419]
Antibody [Unconjugate

AF2685

Simple Western Src [p Tyr419] Antibody [Unconjugated]

Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]

(1 Review)

(10 Publications)

Species: Hu

Applications: IHC, Simple Western, WB

IL-1 RI Antibody
[Unconjugated]

AF771

Neutralization IL-1 RI Antibody [Unconjugated]

(28 Publications)

Species: Mu

Applications: IHC, Neut, WB

Coilin Antibody

NBP2-15939

Immunohistochemistry-Paraffin Coilin Antibody

(2 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, IP, WB

UAF1/WDR48 Antibody

NBP1-81404

(2 Publications)

Species: Hu

Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB

p19ARF/CDKN2A
Antibody - BSA Free

NB200-106

Western Blot p19ARF/CDKN2A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free

(1 Review)

(48 Publications)

Species: Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

S100A9 Antibody
[Unconjugated]

AF2065

Immunohistochemistry S100A9 Antibody [Unconjugated]

(2 Reviews)

(34 Publications)

Species: Mu

Applications: ICC, IHC, Simple Western, WB

p21/CIP1/CDKN1A
Antibody (WA-1)

NBP2-29463

(24 Publications)

Species: Pm, Hu, Pm, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

SF3B14 Antibody

NBP1-87431

Immunohistochemistry-Paraffin SF3B14 Antibody

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

ROBLD3 Antibody

NBP1-71687

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

RPP14 Antibody

NBP1-80965

Immunocytochemistry/ Immunofluorescence RPP14 Antibody

Immunohistochemistry-Paraffin RPP14 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

CDK2AP2 Antibody

H00010263-B01P

Species: Hu, Mu, Rt

Applications: WB

CENPV Antibody

NBP1-84546

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

TCEAL1 Antibody
(OTI2G10)

NBP2-46085

Species: Hu

Applications: IHC, WB

D4S234E Antibody
(1C3)

H00027065-M01

(1 Publication)

Species: Hu, Rt

Applications: ELISA, ICC/IF, S-ELISA, WB

p63/TP73L Antibody
[Unconjugated]

AF1916

Immunocytochemistry p63/TP73L Antibody [Unconjugated]

Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]

(1 Review)

(23 Publications)

Species: Hu

Applications: ICC, IHC, WB

Exosome component
10 Antibody

NBP1-32870

Immunohistochemistry-Paraffin Exosome component 10 Antibody

(2 Reviews)

(3 Publications)

Species: Hu

Applications: IHC, IHC-P, IP, KD, WB

PMEL17/SILV
Antibody (HMB45)

NBP2-44520

Immunohistochemistry PMEL17/SILV Antibody (HMB45)

(8 Publications)

Species: Ca(-), Hu, Rt(-)

Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB

Publications for IFIT3 Protein (NBP2-32500PEP) (0)

There are no publications for IFIT3 Protein (NBP2-32500PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFIT3 Protein (NBP2-32500PEP) (0)

There are no reviews for IFIT3 Protein (NBP2-32500PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IFIT3 Protein (NBP2-32500PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFIT3 Products

Research Areas for IFIT3 Protein (NBP2-32500PEP)

Find related products by research area.

Immunology

Blogs on IFIT3

There are no specific blogs for IFIT3, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.

p19ARF/CDKN2A Antibody - BSA Free
NB200-106

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our IFIT3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

IFIT3

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

IFIT3 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

IFIT3 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for IFIT3 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for IFIT3 Protein (NBP2-32500PEP) (0)

Reviews for IFIT3 Protein (NBP2-32500PEP) (0)

FAQs for IFIT3 Protein (NBP2-32500PEP) (0)

Additional IFIT3 Products

Research Areas for IFIT3 Protein (NBP2-32500PEP)

Blogs on IFIT3

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics