Home » ICK » ICK Proteins » ICK Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ICK Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ICK Protein (NBP1-81459PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ICK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ICK.

Source: E. coli

Amino Acid Sequence: VGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CILK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81459.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ICK Recombinant Protein Antigen

  • EC 2.7.11
  • hICK
  • intestinal cell (MAK-like) kinase
  • Intestinal cell kinase
  • KIAA0936EC 2.7.11.22
  • Laryngeal cancer kinase 2
  • LCK2serine/threonine protein kinase
  • MAK-related kinase
  • MGC46090
  • MRKECO
  • serine/threonine-protein kinase ICK

Background

Eukaryotic protein kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. This gene encodes an intestinal serine/threonine kinase harboring a dual phosphorylation site found in mitogen-activating protein (MAP) kinases. The protein localizes to the intestinal crypt region and is thought to be important in intestinal epithelial cell proliferation and differentiation. Alternative splicing has been observed at this locus and two variants, encoding the same isoform, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MDR1/ABCB1
Antibody (SN06-42)
NBP2-67667
Immunohistochemistry-Paraffin MDR1/ABCB1 Antibody (SN06-42)
Immunohistochemistry-Frozen MDR1/ABCB1 Antibody (SN06-42)
Immunohistochemistry-Paraffin MDR1/ABCB1 Antibody (SN06-42)
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAK Antibody
(OTI5A7)
NBP2-45723
Western Blot MAK Antibody (OTI5A7)
Immunohistochemistry-Paraffin MAK Antibody (OTI5A7)
Immunohistochemistry-Paraffin MAK Antibody (OTI5A7)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
u-Plasminogen
Activator/Urokinase [ ...
1310-SE
Enzyme Activity u-Plasminogen Activator/Urokinase [Unconjugated]
(14 Publications)
Species: Hu
Applications: EnzAct
PMEL17/SILV
Antibody (HMB45)
NBP2-44520
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Immunohistochemistry PMEL17/SILV Antibody (HMB45)
(8 Publications)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
ALPK3 Antibody
(4G4)
H00057538-M01
Immunohistochemistry-Paraffin ALPK3 Antibody (4G4)
Immunocytochemistry/ Immunofluorescence ALPK3 Antibody (4G4)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TBC1D9 Antibody
NBP2-13415
Immunohistochemistry-Paraffin TBC1D9 Antibody
Immunocytochemistry/ Immunofluorescence TBC1D9 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
B3GALNT1 Antibody
- BSA Free
NBP2-92677
Western Blot B3GALNT1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: WB
RPLP1 Antibody
NBP1-81293
Immunohistochemistry-Paraffin RPLP1 Antibody
Immunohistochemistry-Paraffin RPLP1 Antibody
Immunohistochemistry-Paraffin RPLP1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
NUCKS1 Antibody
NB100-74635
Immunohistochemistry-Paraffin NUCKS1 Antibody
Immunoprecipitation NUCKS1 Antibody
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Protamine 1
Antibody
NBP2-30949
Immunohistochemistry-Paraffin Protamine 1 Antibody
Immunohistochemistry-Paraffin Protamine 1 Antibody
Immunohistochemistry-Paraffin Protamine 1 Antibody
Species: Hu
Applications: IHC, IHC-P
Perforin Antibody
(CB5.4) - BSA Free
NBP1-97512
Western Blot Perforin Antibody (CB5.4) - BSA Free
(7 Publications)
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
CD77 Synthase
Antibody
NBP1-62583
Western Blot CD77 Synthase Antibody
(2 Publications)
Species: Hu
Applications: WB
AgRP/ART [HRP]
DAGR00
N/A AgRP/ART [HRP]
N/A AgRP/ART [HRP]
N/A AgRP/ART [HRP]
(3 Publications)
Species: Hu
Applications: ELISA
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin SGSM3 Antibody
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody
Western Blot SGSM3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ICK Protein (NBP1-81459PEP) (0)

There are no publications for ICK Protein (NBP1-81459PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICK Protein (NBP1-81459PEP) (0)

There are no reviews for ICK Protein (NBP1-81459PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ICK Protein (NBP1-81459PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ICK Products

Research Areas for ICK Protein (NBP1-81459PEP)

Find related products by research area.

Blogs on ICK

There are no specific blogs for ICK, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH-3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2.
Catalase Antibody [Unconjugated]
AF3398

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ICK Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CILK1