Frizzled-4 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Frizzled-4. Source: E. coli Amino Acid Sequence: PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
FZD4 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57807. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Frizzled-4 Recombinant Protein Antigen
Background
FZD4 is a Frizzled Receptor involved in mediating Wnt signaling. A splicing variant of frizzled-4, FZD4s, encodes a soluble-type positive regulator of the Wnt signaling pathway. Mutations in FZD4 are associated with retinal angiogenesis. FZD4 is widely expressed, particularly in heart, skeletal muscle, ovary, and fetal kidney. Transcripts have also been identified in liver, kidney, pancreas, spleen, and fetal lung, and in smaller amounts in placenta, adult lung, prostate, testis, colon, and fetal brain. FZD4 expression has not been reported in several cancer cell lines studied. ESTs have been isolated from adipose, adrenal, B-cell/lung/testis, bone marrow, brain, breast, colon, embryo, gallbladder, head/neck, heart, heart/melanocyte/uterus, kidney, liver, liver/spleen, lung, placenta, prostate, skeletal muscle, skin, and vessel libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for Frizzled-4 Recombinant Protein Antigen (NBP2-57807PEP) (0)
There are no publications for Frizzled-4 Recombinant Protein Antigen (NBP2-57807PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Frizzled-4 Recombinant Protein Antigen (NBP2-57807PEP) (0)
There are no reviews for Frizzled-4 Recombinant Protein Antigen (NBP2-57807PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Frizzled-4 Recombinant Protein Antigen (NBP2-57807PEP) (0)
Additional Frizzled-4 Products
Research Areas for Frizzled-4 Recombinant Protein Antigen (NBP2-57807PEP)
Find related products by research area.
|
Blogs on Frizzled-4