Reactivity | HuSpecies Glossary |
Applications | WB, IHC |
Clone | CL0268 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | PerCP |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFGAPHR |
Isotype | IgG1 |
Clonality | Monoclonal |
Host | Mouse |
Gene | ERBB2 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Optimal dilution of this antibody should be experimentally determined. |
Storage | Store at 4C in the dark. |
Buffer | PBS |
Preservative | 0.05% Sodium Azide |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ErbB2/Her2 Antibody (NBP2-52896PCP)Find related products by research area.
|
Unlocking the Potential of Biosimilars in Immuno-Oncology By Jennifer Jones, M.S.Biosimilar Antibodies: Imitation Meets InnovationIn the ever-evolving medical landscape, a new class of pharmaceuticals is emerging as a game-changer, poised to transform the way we approach... Read full blog post. |
NPC1: A Potential Target For Triple-Negative Breast Cancer By Natalia Gurule, PhD Breast Cancer is a Heterogeneous DiseaseBreast cancer is the most frequently identified malignancy in women, accounting for 30% of diagnosed cases of cancer in women in the US annuall... Read full blog post. |
Hypoxia-Dependent CAR Stabilizing Construct in T cells Improves Solid Tumor Targeting and Efficacy By Victoria Osinski, PhDDespite advances in the development of cancer immunotherapies, those specifically targeting tumors still remains limited. Currently, there is great interest in utilizing chimeric antigen rece... Read full blog post. |
Harnessing Natural Killer Cell Activity for Anti-Tumor Immunotherapy By Victoria Osinski, PhDWhat’s “Natural” About Natural Killer (NK) Cells?For immunologists, the term cytotoxicity often conjures up images of an army of antigen specific CD8+ T cells deploying to ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ERBB2 |