Novus Biologicals products are now on bio-techne.com

Aquaporin-2 Recombinant Protein Antigen

Images

 
There are currently no images for Aquaporin-2 Protein (NBP2-33472PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Aquaporin-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AQP2.

Source: E. coli

Amino Acid Sequence: VLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AQP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33472.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aquaporin-2 Recombinant Protein Antigen

  • ADH water channel
  • AQP-2
  • AQP-CD
  • aquaporin 2 (collecting duct)
  • aquaporin-2
  • aquaporin-CD
  • Collecting duct water channel protein
  • MGC34501
  • Water channel protein for renal collecting duct
  • water-channel aquaporin 2
  • WCH-CD

Background

Aquaporin 2 (AQP2) is a membrane protein that is involved in plasma membrane water transport in the renal collecting duct. Specifically, AQP2 forms a water-specific channel, providing the renal collecting duct plasma membranes with a high permeability to water and thereby permitting osmosis.

Aquaporin-2 antibodies serve as membrane markers and are useful for renal function studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF009
Species: Hu
Applications: IHC, WB
NB600-749
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF245
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
NLS272
Species: Ha, Hu, Pm, Mu, Rb, Rt
Applications: IHC, IHC-Fr, IHC-P
NBP1-97927
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87679
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-39043
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-30862
Species: Eq, Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, WB

Publications for Aquaporin-2 Protein (NBP2-33472PEP) (0)

There are no publications for Aquaporin-2 Protein (NBP2-33472PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aquaporin-2 Protein (NBP2-33472PEP) (0)

There are no reviews for Aquaporin-2 Protein (NBP2-33472PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Aquaporin-2 Protein (NBP2-33472PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aquaporin-2 Products

Research Areas for Aquaporin-2 Protein (NBP2-33472PEP)

Find related products by research area.

Blogs on Aquaporin-2.

Hsc70 - a chaperone protein with diverse cellular functions
Heat shock cognate 71 kDa protein (Hsc70), also known as HSPA8, is a member of the heat shock protein 70 family (Hsp70). Unlike Hsp70, it is a constitutively expressed chaperone protein and is involved in diverse cellular processes including protei...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aquaporin-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AQP2