Home » FAM125A » FAM125A Proteins » FAM125A Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

FAM125A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FAM125A Protein (NBP1-91882PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

  • Size / Catalog#QtyPrice
    FAB80841C
    0.1 ml
    $549.00
    2-4 Business Days
Novus Biologicals offers 100% Guarantee
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research

FAM125A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MVB12A.

Source: E. coli

Amino Acid Sequence: LGATDTAVFDVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MVB12A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91882.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FAM125A Recombinant Protein Antigen

  • CFBP
  • CIN85/CD2AP family binding protein
  • CIN85/CD2AP family-binding protein
  • ESCRT-I complex subunit MVB12A
  • family with sequence similarity 125, member A
  • FLJ32495
  • multivesicular body subunit 12A
  • Protein FAM125A

Background

FAM125A is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting ofendocytic ubiquitinated cargos into multivesicular bodies. May be involved in the ligand-mediated internalization anddown-regulation of EGF receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Plexin A1 Antibody
[Unconjugated]
AF4309
Immunohistochemistry Plexin A1 Antibody [Unconjugated]
•••
(12 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
RPL10 Antibody -
BSA Free
NBP1-84037
Immunohistochemistry-Paraffin RPL10 Antibody - BSA Free
•••
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
EphB2 Antibody [Unconjugated]
AF467

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FAM125A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MVB12A