Novus Biologicals products are now on bio-techne.com

PDX-1/IPF1 Recombinant Protein Antigen

Name: PDX-1/IPF1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-38865PEP
Price: 279 USD

Images

There are currently no images for PDX-1/IPF1 Protein (NBP2-38865PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

100% Guarantee on every product

PDX-1/IPF1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDX1. Source: E. coli Amino Acid Sequence: DISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	PDX1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38865. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDX-1/IPF1 Recombinant Protein Antigen

Glucose-sensitive factor
IDX1
IDX-1GSF
Insulin promoter factor 1
insulin promoter factor 1, homeodomain transcription factor
Insulin upstream factor 1
IPF1
IPF1pancreas/duodenum homeobox protein 1
Islet/duodenum homeobox-1
MODY4IUF1
pancreatic and duodenal homeobox 1
pancreatic-duodenal homeobox factor 1
PDX-1
PDX-1IPF-1
somatostatin transcription factor 1
Somatostatin-transactivating factor 1
STF-1IUF-1

Background

PDX1 (Pancrease/duodenum homeobox 1, Insulin promoter factor 1, IPF1, Islet/duodenum homeobox 1, IDX1, Somatatostatin transactivating factor 1, STF1, Insulin upstream factor 1, UUF1, Glucose-sensitive factor, GSF) activates transcription of the insulin and somatostain genes. PDX1 is required for maintaining the hormone-producing phenotype of the beta-cell.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

Neurogenin-3
Antibody [Unconjugate

AF3444

Immunohistochemistry Neurogenin-3 Antibody [Unconjugated]

(19 Publications)

Species: Hu

Applications: IHC, WB

Glucokinase/GCK
Antibody (OTI3E3)

NBP1-47778

Immunohistochemistry-Paraffin Glucokinase/GCK Antibody (OTI3E3)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Glucagon Antibody
(181402) [Unconjugate ...

MAB1249

Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]

(1 Review)

(13 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, ICC, ICFlow

Glut2 Antibody -
BSA Free

NBP2-22218

Immunohistochemistry-Paraffin Glut2 Antibody - BSA Free

(2 Reviews)

(15 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

NeuroD1 Antibody
[Unconjugated]

AF2746

(17 Publications)

Species: Hu, Mu

Applications: ICC, WB

NKX6.1 Antibody -
BSA Free

NBP1-49672

Immunohistochemistry NKX6.1 Antibody - BSA Free

(4 Reviews)

(16 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB

Somatostatin
Antibody (7G5) - BSA

NBP2-37447

Immunohistochemistry-Paraffin Somatostatin Antibody (7G5) - BSA Free

ELISA Somatostatin Antibody (7G5) - BSA Free

(1 Review)

(2 Publications)

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB

HNF1 Antibody

NBP1-33596

(6 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB

TCF-2/HNF-1 beta
Antibody

NBP1-89680

Immunohistochemistry-Paraffin TCF-2/HNF-1 beta Antibody

(1 Review)

(7 Publications)

Species: Hu, Mu

Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB

HNF-3 beta/FoxA2
Antibody [Unconjugate ...

AF2400

Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]

Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]

(96 Publications)

Species: Hu

Applications: ChIP, ICC, IHC, WB

HNF-4 alpha/NR2A1
Antibody

NBP1-89679

(1 Review)

(4 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Amylin Antibody

NBP2-33680

Immunohistochemistry-Paraffin Amylin Antibody

Species: Hu

Applications: IHC, IHC-P

Pax6 Antibody
[Unconjugated]

AF8150

Immunocytochemistry Pax6 Antibody [Unconjugated]

Western Blot Pax6 Antibody [Unconjugated]

(15 Publications)

Species: Hu

Applications: ICC, ICFlow, Simple Western, WB

Pax4 Antibody

AF2614

(2 Publications)

Species: Hu

Applications: ICC, WB

Islet-1 Antibody
[Unconjugated]

AF1837

Western Blot Islet-1 Antibody [Unconjugated]

Immunocytochemistry Islet-1 Antibody [Unconjugated]

(36 Publications)

Species: Hu

Applications: ICC, IHC, Simple Western, WB

MafA Antibody

NB400-137

(1 Review)

(41 Publications)

Species: Hu, Mu

Applications: ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Nestin Antibody
(196908) [Unconjugate

MAB1259

Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]

Western Blot Nestin Antibody (196908) [Unconjugated]

(3 Reviews)

(157 Publications)

Species: Hu

Applications: CyTOF-reported, ICC, ICFlow

Cytokeratin 19
Antibody - BSA Free

NB100-687

Western Blot Cytokeratin 19 Antibody - BSA Free

Immunohistochemistry Cytokeratin 19 Antibody - BSA Free

(1 Review)

(9 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB

PDX-1/IPF1
Recombinant Protein A

NBP2-38865PEP

Species: Hu

Applications: AC

Publications for PDX-1/IPF1 Protein (NBP2-38865PEP) (0)

There are no publications for PDX-1/IPF1 Protein (NBP2-38865PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDX-1/IPF1 Protein (NBP2-38865PEP) (0)

There are no reviews for PDX-1/IPF1 Protein (NBP2-38865PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PDX-1/IPF1 Protein (NBP2-38865PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDX-1/IPF1 Products

Research Areas for PDX-1/IPF1 Protein (NBP2-38865PEP)

Find related products by research area.

Blogs on PDX-1/IPF1

There are no specific blogs for PDX-1/IPF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nestin was detected in immersion fixed human fetal neural progenitor cells using 10 µg/mL Human Nestin Monoclonal Antibody (Catalog # MAB1259) for 3 hours at room temperature. Cells were stained (green) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Nestin Antibody (196908) [Unconjugated]
MAB1259

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our PDX-1/IPF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

PDX1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

PDX-1/IPF1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

PDX-1/IPF1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for PDX-1/IPF1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for PDX-1/IPF1 Protein (NBP2-38865PEP) (0)

Reviews for PDX-1/IPF1 Protein (NBP2-38865PEP) (0)

FAQs for PDX-1/IPF1 Protein (NBP2-38865PEP) (0)

Additional PDX-1/IPF1 Products

Research Areas for PDX-1/IPF1 Protein (NBP2-38865PEP)

Blogs on PDX-1/IPF1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics