Immunocytochemistry/ Immunofluorescence: PDX-1/IPF1 Antibody [NBP2-38865] - Staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PDX-1/IPF1 Antibody [NBP2-38865] - Staining of human prostate shows no positivity in glandular cells as expected.
Immunohistochemistry: PDX-1/IPF1 Antibody [NBP2-38865] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells and islets of Langerhans.
Immunohistochemistry-Paraffin: PDX-1/IPF1 Antibody [NBP2-38865] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: PDX-1/IPF1 Antibody [NBP2-38865] - Staining of human prostate shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PDX-1/IPF1 Antibody [NBP2-38865] - Analysis in human duodenum and cerebral cortex tissues using NBP2-38865 antibody. Corresponding PDX1 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: PDX-1/IPF1 Antibody [NBP2-38865] - Staining of human pancreas shows strong nuclear positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: PDX-1/IPF1 Antibody [NBP2-38865] - Staining of human duodenum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PDX-1/IPF1 Antibody [NBP2-38865] - Staining of human cerebral cortex shows no positivity in neurons as expected.
This antibody was developed against a recombinant protein corresponding to amino acids: DISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
PDX1 (Pancrease/duodenum homeobox 1, Insulin promoter factor 1, IPF1, Islet/duodenum homeobox 1, IDX1, Somatatostatin transactivating factor 1, STF1, Insulin upstream factor 1, UUF1, Glucose-sensitive factor, GSF) activates transcription of the insulin and somatostain genes. PDX1 is required for maintaining the hormone-producing phenotype of the beta-cell.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PDX-1/IPF1 Antibody and receive a gift card or discount.