Home » TAS2R38 » TAS2R38 Proteins » TAS2R38 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TAS2R38 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TAS2R38 Protein (NBP2-33404PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TAS2R38 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAS2R38.

Source: E. coli

Amino Acid Sequence: SLGRHMRTMKVYTRNSRDPSLEAHIKALKS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TAS2R38
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33404.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TAS2R38 Recombinant Protein Antigen

  • PTCphenylthiocarbamide tasting
  • T2R38
  • T2R61PTC bitter taste receptor
  • taste receptor type 2 member 38
  • Taste receptor type 2 member 61
  • taste receptor, type 2, member 38

Background

The STAS2R38 gene encodes a 333 amino acid long, 37 kDA taste receptor type 2 member 38 protein that obtains the ability to identify the perception of bitterness as it obtains the capabilities of tasting glucosinolates. Additionally, many believe that this receptor has the ability to stimulate alpha gustducin to regulate PLC-beta-2 activation. In doing so, it would lead to the gating of TRPM5. Therefore, the STAS2R38 gene is involved in taste transduction and bitter taste signaling. It has been researched regarding its role in thyroiditis, dental caries, nicotine dependence, motion sickness, phenylthiocarbamide tasting, coronary heart disease, alcoholism, and twining.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ret Antibody
[Unconjugated]
AF482
Immunohistochemistry Ret Antibody [Unconjugated]
Western Blot Ret Antibody [Unconjugated]
Immunohistochemistry Ret Antibody [Unconjugated]
(40 Publications)
Species: Mu
Applications: IHC, WB
B-Raf Antibody
(OTI5A9)
NBP1-47668
Immunohistochemistry B-Raf Antibody (OTI5A9)
Western Blot B-Raf Antibody (OTI5A9)
Flow Cytometry B-Raf Antibody (OTI5A9)
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(69 Publications)
Species: Mu
Applications: BA
Recombinant Human
Fucosyltransferase 1/ ...
H00002523-P01
Other Recombinant Human Fucosyltransferase 1/FUT1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Patched 1/PTCH
Antibody (413220) [Un ...
MAB41051
Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
(10 Publications)
Species: Hu, Mu
Applications: IHC, WB
HFE Antibody (1G12)
H00003077-M01
Western Blot HFE Antibody (1G12)
Immunocytochemistry/ Immunofluorescence HFE Antibody (1G12)
Western Blot HFE Antibody (1G12)
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NCOA4 Antibody
(1B7)
H00008031-M04
ELISA NCOA4 Antibody (1B7)
Immunocytochemistry/ Immunofluorescence NCOA4 Antibody (1B7)
Western Blot NCOA4 Antibody (1B7)
(5 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Smoothened
Antibody - BSA Free
NLS2666
Immunohistochemistry-Paraffin Smoothened Antibody - BSA Free
(1 Publication)
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
SMOX Antibody -
Azide and BSA Free
NBP3-04509
Immunohistochemistry-Paraffin SMOX Antibody - Azide and BSA Free
Western Blot SMOX Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin SMOX Antibody - Azide and BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
GLI-1 Antibody -
BSA Free
NB600-600
Immunohistochemistry-Paraffin GLI-1 Antibody - BSA Free
Knockdown Validated GLI-1 Antibody - BSA Free
Immunohistochemistry-Paraffin GLI-1 Antibody - BSA Free
(1 Review)
(55 Publications)
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
TrkA Antibody
[Unconjugated]
AF1056
Immunohistochemistry TrkA Antibody [Unconjugated]
Western Blot TrkA Antibody [Unconjugated]
Immunohistochemistry TrkA Antibody [Unconjugated]
(44 Publications)
Species: Rt
Applications: IHC, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
PLA1A Antibody -
BSA Free
NBP2-82024
Western Blot PLA1A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PLA1A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PLA1A Antibody - BSA Free
Species: Hu, Rt
Applications: ELISA, ICC/IF, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(683 Publications)
Species: Hu
Applications: ELISA
RENT1/UPF1/hUPF1
Antibody
NB100-368
Western Blot RENT1/UPF1/hUPF1 Antibody
Western Blot RENT1/UPF1/hUPF1 Antibody
(10 Publications)
Species: Hu, Mu
Applications: WB
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin NDUFB6 Antibody
Western Blot NDUFB6 Antibody
Immunocytochemistry/ Immunofluorescence NDUFB6 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Indian
Hedgehog/Ihh Antibody ...
AF1705
Immunohistochemistry Indian Hedgehog/Ihh Antibody - N-Terminus
(3 Publications)
Species: Mu
Applications: IHC, WB

Publications for TAS2R38 Protein (NBP2-33404PEP) (0)

There are no publications for TAS2R38 Protein (NBP2-33404PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAS2R38 Protein (NBP2-33404PEP) (0)

There are no reviews for TAS2R38 Protein (NBP2-33404PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TAS2R38 Protein (NBP2-33404PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAS2R38 Products

Research Areas for TAS2R38 Protein (NBP2-33404PEP)

Find related products by research area.

Blogs on TAS2R38

There are no specific blogs for TAS2R38, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TAS2R38 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TAS2R38