Home » SLC17A2 » SLC17A2 Proteins » SLC17A2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SLC17A2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SLC17A2 Protein (NBP1-82536PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SLC17A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC17A2.

Source: E. coli

Amino Acid Sequence: AIIAMVNTTQQQGLSNASTEGPVADAFNNSSISIKEFDTKASVYQWSPETQG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC17A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82536.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC17A2 Recombinant Protein Antigen

  • MGC138238
  • NPT3member 2
  • solute carrier family 17 (sodium phosphate), member 2

Background

An excitatory neurotransmitter glutamate is stored in synaptic vesicles. Excitatory neurons release glutamate by exocytosis into the synaptic cleft in response to neuronal stimulation. Members of the solute carrier family 17 are classified as vesicular glutamate transporters, which participate in the accumulation of glutamate in synaptic vesicles. SLC17A2/NPT3 is predominantly expressed in the heart and skeletal muscles, and weakly in the brain, placenta, lung, liver, and pancreas at the transcriptional level. In addition, SLC17A2/NPT3 mediates the transport of extracellular phosphates into chondrocytes of the growth-plate cartilages.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SLC34A1 Antibody
(10B1.3E9) - BSA Free
NBP2-42216
Flow Cytometry SLC34A1 Antibody (10B1.3E9) - BSA Free
Flow Cytometry SLC34A1 Antibody (10B1.3E9) - BSA Free
Flow Cytometry SLC34A1 Antibody (10B1.3E9) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunocytochemistry/ Immunofluorescence Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunohistochemistry-Paraffin Glutathione S-Transferase pi 1/GSTP1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Serpin A1/alpha
1-Antitrypsin Antibod ...
MAB1268
Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
(1 Review)
(13 Publications)
Species: Hu
Applications: ICC, IHC, IP, Simple Western, WB
PHEX
8090-ZN
PHEX
Species: Hu
Applications: EnzAct
SLC20A1 Antibody
NBP1-32252
Western Blot SLC20A1 Antibody
Immunohistochemistry-Paraffin SLC20A1 Antibody
Immunohistochemistry-Paraffin SLC20A1 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
HNF1 Antibody
NBP1-33596
Western Blot HNF1 Antibody
Western Blot HNF1 Antibody
Immunoprecipitation HNF1 Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
NHERF-1 Antibody
NBP3-35065
NHERF-1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, WB
SLC20A2 Antibody
(4B1)
H00006575-M04
ELISA SLC20A2 Antibody (4B1)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, WB
TCF-2/HNF-1 beta
Antibody
NBP1-89680
Immunocytochemistry/ Immunofluorescence TCF-2/HNF-1 beta Antibody
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta Antibody
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
SLC17A3 Antibody -
Azide and BSA Free
NBP3-25684
Western Blot SLC17A3 Antibody - Azide and BSA Free
Western Blot SLC17A3 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin SLC17A3 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
FGF-23 Antibody
(283507) [Unconjugate
MAB26291
Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]
Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]
Western Blot FGF-23 Antibody (283507) [Unconjugated]
(22 Publications)
Species: Mu
Applications: IHC
CYP24A1 Antibody
NBP1-85495
Immunohistochemistry-Paraffin CYP24A1 Antibody
Immunohistochemistry-Paraffin CYP24A1 Antibody
Immunohistochemistry-Paraffin CYP24A1 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot beta-Actin Antibody (AC-15)
Simple Western beta-Actin Antibody (AC-15)
Western Blot beta-Actin Antibody (AC-15)
(27 Reviews)
(594 Publications)
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
SLC34A3 Antibody
NBP1-81933
Immunohistochemistry-Paraffin SLC34A3 Antibody
Immunohistochemistry-Paraffin SLC34A3 Antibody
Immunohistochemistry-Paraffin SLC34A3 Antibody
Species: Hu
Applications: IHC, IHC-P
PTHLH/PTHrP
Antibody (677939) [Un ...
MAB6734
Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]
(2 Publications)
Species: Hu
Applications: IHC

Publications for SLC17A2 Protein (NBP1-82536PEP) (0)

There are no publications for SLC17A2 Protein (NBP1-82536PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC17A2 Protein (NBP1-82536PEP) (0)

There are no reviews for SLC17A2 Protein (NBP1-82536PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC17A2 Protein (NBP1-82536PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC17A2 Products

Blogs on SLC17A2

There are no specific blogs for SLC17A2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC17A2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC17A2