Home » SIRT7 » SIRT7 Proteins » SIRT7 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SIRT7 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SIRT7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIRT7

Source: E.coli

Amino Acid Sequence: LVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADLSEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SIRT7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21247. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SIRT7 Recombinant Protein Antigen

  • EC 3.5.1.-
  • MGC126840
  • MGC126842
  • silent mating type information regulation 2, S.cerevisiae, homolog 7
  • SIR2L7
  • SIR2L7NAD-dependent deacetylase sirtuin-7
  • SIR2-like protein 7
  • sir2-related protein type 7
  • sirtuin (silent mating type information regulation 2 homolog) 7 (S. cerevisiae)
  • sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7
  • Sirtuin 7
  • sirtuin type 7

Background

SIRT7 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. SIRT7 is included in class IV. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT7 is included in class IV of the sirtuin family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Sir2.1 Antibody
NB100-1923
Western Blot Sir2.1 Antibody
(1 Review)
(2 Publications)
Species: Ce
Applications: IHC, IHC-P, IP, WB
Sirtuin 1/SIRT1
Antibody (1F3) - BSA ...
NBP1-51641
Immunohistochemistry-Paraffin Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free
Flow Cytometry Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free
Immunocytochemistry/ Immunofluorescence Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free
(9 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
SIRT6 Antibody
NB100-2524
Western Blot SIRT6 Antibody
Immunocytochemistry/ Immunofluorescence SIRT6 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
Sirtuin 3/SIRT3
Antibody (6B2A1) - BS ...
NBP2-52563
Immunohistochemistry Whole-Mount Sirtuin 3/SIRT3 Antibody (6B2A1) - BSA Free
Flow Cytometry Sirtuin 3/SIRT3 Antibody (6B2A1) - BSA Free
Western Blot Sirtuin 3/SIRT3 Antibody (6B2A1) - BSA Free
(1 Review)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC-WhMt, IHC, IHC-P, WB
Sirtuin 5/SIRT5
Antibody
NBP1-86013
Immunohistochemistry-Paraffin Sirtuin 5/SIRT5 Antibody
Immunohistochemistry-Paraffin Sirtuin 5/SIRT5 Antibody
Immunohistochemistry-Paraffin Sirtuin 5/SIRT5 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
SIRT4 Antibody
NB100-1406
Western Blot SIRT4 Antibody
Immunohistochemistry-Paraffin SIRT4 Antibody
Western Blot SIRT4 Antibody
(5 Publications)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(221 Publications)
Species: Hu
Applications: BA
Recombinant Human
HIST1H4I GST (N-Term) ...
H00008294-P01
SDS-PAGE Recombinant Human HIST1H4I GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Histone H4 Antibody
AF5215
Western Blot Histone H4 Antibody
Immunocytochemistry Histone H4 Antibody
(6 Publications)
Species: Hu, Mu
Applications: ICC, WB
HDAC9 Antibody -
BSA Free
NBP2-03993
Western Blot HDAC9 Antibody - BSA Free
(1 Review)
(1 Publication)
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
WSTF Antibody
NB600-279
Western Blot WSTF Antibody
Immunohistochemistry-Paraffin WSTF Antibody
Immunoprecipitation WSTF Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
SMARCA5/SNF2H
Antibody
NB100-55310
Western Blot SMARCA5/SNF2H Antibody
Western Blot SMARCA5/SNF2H Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: IP, WB
MYBBP1A Antibody
NB100-61050
Immunohistochemistry-Paraffin MYBBP1A Antibody
Immunoprecipitation MYBBP1A Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, PLA, WB
Peroxiredoxin 2
Antibody (4E10-2D2)
H00007001-M01
ELISA Peroxiredoxin 2 Antibody (4E10-2D2)
Knockdown Validated Peroxiredoxin 2 Antibody (4E10-2D2)
Western Blot Peroxiredoxin 2 Antibody (4E10-2D2)
(1 Review)
(6 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot HIST1H4F Overexpression Lysate
Species: Hu
Applications: WB
H4/e
Overexpression Lysate
NBL1-11570
Western Blot H4/e Overexpression Lysate
Species: Hu
Applications: WB

Publications for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP) (0)

There are no publications for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP) (0)

There are no reviews for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SIRT7 Products

Research Areas for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP)

Find related products by research area.

Blogs on SIRT7

There are no specific blogs for SIRT7, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

ELISA: Peroxiredoxin 2 Antibody (4E1.0-2D2) [H00007001-M01] - Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Detection limit for recombinant GST tagged PRDX2 is approximately 1ng/ml as a capture antibody.
Peroxiredoxin 2 Antibody (4E10-2D2)
H00007001-M01

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SIRT7 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SIRT7