Novus Biologicals products are now on bio-techne.com

PITRM1 Recombinant Protein Antigen

Name: PITRM1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-81729PEP
Price: 279 USD

Images

There are currently no images for PITRM1 Protein (NBP1-81729PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PITRM1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PITRM1. Source: E. coli Amino Acid Sequence: ELRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEI Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	PITRM1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81729. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PITRM1 Recombinant Protein Antigen

EC 3.4.24
EC 3.4.24.-
hPreP
Metalloprotease 1
MGC138192
MGC141929
pitrilysin metallopeptidase 1
Pitrilysin metalloproteinase 1mitochondrial
PreP

Background

ATP-independent protease that degrades mitochondrial transit peptides after their cleavage. Also degrades other unstructured peptides. Specific for peptides in the range of 10 to 65 residues. Able to degrade amyloid beta A4 (APP) protein when it accumulates in mitochondrion, suggesting a link with Alzheimer disease. Shows a preference for cleavage after small polar residues and before basic residues, but without any positional preference

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FABP8/M-FABP/Myelin P2

AF5866

Immunohistochemistry FABP8/M-FABP/Myelin P2 Protein Antibody

Species: Hu

Applications: IHC, WB

ROBLD3 Antibody

NBP1-71687

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

Prostatic Acid
Phosphatase/ACPP Anti ...

AF6240

Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]

ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]

(1 Publication)

Species: Hu

Applications: ELISA, IHC, WB

PAPOLA Antibody

NBP1-87345

Immunocytochemistry/ Immunofluorescence PAPOLA Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

MRPS30 Antibody

NBP1-87343

Species: Hu, Rt

Applications: IHC, IHC-P, WB

PAG3 Antibody

NBP2-24614

Species: Hu, Mu, Ma-Op, Pm, Rt

Applications: WB

Reg3A Antibody

NBP2-24763

Immunohistochemistry-Paraffin Reg3A Antibody

(3 Publications)

Species: Hu, Pm

Applications: IHC, IHC-P, WB

ASAP1 Antibody

NBP2-48909

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, KO

TUSC2 Antibody -
BSA Free

NBP3-04411

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

PDAP1 Antibody

NBP3-20223

Immunocytochemistry/ Immunofluorescence PDAP1 Antibody

Species: Hu

Applications: ICC/IF, IP, WB

MEK1 Antibody
(OTI1F5)

NBP1-47833

Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)

(1 Review)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

PKNOX1 Antibody

NBP2-19853

Immunocytochemistry/ Immunofluorescence PKNOX1 Antibody

(1 Publication)

Species: Hu

Applications: ChIP, ICC/IF, IP, WB

p19ARF/CDKN2A
Antibody - BSA Free

NB200-106

Western Blot p19ARF/CDKN2A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free

(1 Review)

(48 Publications)

Species: Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

SUB1 Antibody

NBP1-82454

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

PMEL17/SILV
Antibody (HMB45)

NBP2-44520

Immunohistochemistry PMEL17/SILV Antibody (HMB45)

(8 Publications)

Species: Ca(-), Hu, Rt(-)

Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB

S100A9 Antibody
[Unconjugated]

AF2065

Immunohistochemistry S100A9 Antibody [Unconjugated]

(2 Reviews)

(34 Publications)

Species: Mu

Applications: ICC, IHC, Simple Western, WB

RPP14 Antibody

NBP1-80965

Immunocytochemistry/ Immunofluorescence RPP14 Antibody

Immunohistochemistry-Paraffin RPP14 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

PBX1 Antibody (4A2)

H00005087-M01

Immunocytochemistry/ Immunofluorescence PBX1 Antibody (4A2)

Immunohistochemistry-Paraffin PBX1 Antibody (4A2)

(12 Publications)

Species: Hu, Pm, Mu

Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB

CDK2AP2 Antibody

H00010263-B01P

Species: Hu, Mu, Rt

Applications: WB

Publications for PITRM1 Protein (NBP1-81729PEP) (0)

There are no publications for PITRM1 Protein (NBP1-81729PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PITRM1 Protein (NBP1-81729PEP) (0)

There are no reviews for PITRM1 Protein (NBP1-81729PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PITRM1 Protein (NBP1-81729PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PITRM1 Products

Blogs on PITRM1

There are no specific blogs for PITRM1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.

p19ARF/CDKN2A Antibody - BSA Free
NB200-106

S100A9 was detected in immersion fixed XB2 mouse teratoma keratinocyte cell line using 10 µg/mL Goat Anti-Mouse S100A9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2065) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counte-rstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

S100A9 Antibody [Unconjugated]
AF2065

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our PITRM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

PITRM1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

PITRM1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

PITRM1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for PITRM1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for PITRM1 Protein (NBP1-81729PEP) (0)

Reviews for PITRM1 Protein (NBP1-81729PEP) (0)

FAQs for PITRM1 Protein (NBP1-81729PEP) (0)

Additional PITRM1 Products

Blogs on PITRM1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics