Home » KLF5 » KLF5 Proteins » KLF5 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

KLF5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for KLF5 Protein (NBP1-88508PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

KLF5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KLF5.

Source: E. coli

Amino Acid Sequence: TYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KLF5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88508.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KLF5 Recombinant Protein Antigen

  • Basic transcription element-binding protein 2
  • BTEB2
  • BTE-binding protein 2
  • CKLFGC-box-binding protein 2
  • Colon krueppel-like factor
  • colon kruppel-like factor
  • GC box binding protein 2
  • IKLFbasic transcription element binding protein 2
  • Intestinal-enriched krueppel-like factor
  • intestinal-enriched kruppel-like factor
  • KLF5
  • Krueppel-like factor 5
  • Kruppel-like factor 5 (intestinal)
  • Transcription factor BTEB2

Background

KLF5 encodes a member of the Kruppel-like factor subfamily of zinc finger proteins. Since the protein localizes to the nucleus and binds the epidermal growth factor response element, it is thought to be a transcription factor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

KLF4 Antibody
[Unconjugated]
AF3158
Chromatin Immunoprecipitation (ChIP) KLF4 Antibody [Unconjugated]
Immunocytochemistry KLF4 Antibody [Unconjugated]
Immunohistochemistry KLF4 Antibody [Unconjugated]
(2 Reviews)
(88 Publications)
Species: Mu
Applications: ChIP, ICC, IHC, WB
EGR1 Antibody
[Unconjugated]
AF2818
Immunocytochemistry EGR1 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: ICC, WB
SP1 Antibody
NB600-232
Western Blot SP1 Antibody
Immunohistochemistry-Paraffin SP1 Antibody
Western Blot SP1 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
KLF2 Antibody
(665333)
MAB5466
Immunocytochemistry KLF2 Antibody (665333)
Intracellular Staining by Flow Cytometry KLF2 Antibody (665333)
(4 Publications)
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
COCO/DAND5
[Unconjugated]
3047-CC
COCO/DAND5 [Unconjugated]
(4 Publications)
Species: Hu
Applications: BA
PSG1 [HRP]
DPSG10
N/A PSG1 [HRP]
N/A PSG1 [HRP]
(2 Publications)
Species: Hu
Applications: ELISA
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CEBP Beta Antibody
(47A1) - BSA Free
NBP1-04266
Western Blot CEBP Beta Antibody (47A1) - BSA Free
Western Blot CEBP Beta Antibody (47A1) - BSA Free
(1 Review)
Species: Hu
Applications: ELISA, ICC/IF, WB
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
(1 Review)
(9 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
KLF9 Antibody
(OTI8A11)
NBP2-45511
Immunohistochemistry KLF9 Antibody (OTI8A11)
Immunohistochemistry KLF9 Antibody (OTI8A11)
Immunohistochemistry KLF9 Antibody (OTI8A11)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PDGF-AA
[Unconjugated]
221-AA
Bioactivity PDGF-AA [Unconjugated]
Cell Culture PDGF-AA [Unconjugated]
(57 Publications)
Species: Hu
Applications: BA
RAR alpha/NR1B1
Antibody (763)
NB200-322
Western Blot RAR alpha/NR1B1 Antibody (763)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
KLF1 Antibody
(1B6A3) - BSA Free
NBP2-37380
ELISA KLF1 Antibody (1B6A3) - BSA Free
Western Blot KLF1 Antibody (1B6A3) - BSA Free
Flow Cytometry KLF1 Antibody (1B6A3) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB

Publications for KLF5 Protein (NBP1-88508PEP) (0)

There are no publications for KLF5 Protein (NBP1-88508PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF5 Protein (NBP1-88508PEP) (0)

There are no reviews for KLF5 Protein (NBP1-88508PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KLF5 Protein (NBP1-88508PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KLF5 Products

Research Areas for KLF5 Protein (NBP1-88508PEP)

Find related products by research area.

Blogs on KLF5.

Check out the latest blog posts on KLF5.
KLF4 as a transcription factor in stem cell differentiation
Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

D3 mouse embryonic stem cell line was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. KLF4/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Mouse KLF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3158) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The B2R promoter was detected by standard PCR.
KLF4 Antibody [Unconjugated]
AF3158
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
EphB2 Antibody [Unconjugated]
AF467

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KLF5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol KLF5