Home » Bradykinin RB2/BDKRB2 » Bradykinin RB2/BDKRB2 Proteins » Bradykinin RB2/BDKRB2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Bradykinin RB2/BDKRB2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Bradykinin RB2/BDKRB2 Protein (NBP2-14351PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Bradykinin RB2/BDKRB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BDKRB2.

Source: E. coli

Amino Acid Sequence: FSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BDKRB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14351.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Bradykinin RB2/BDKRB2 Recombinant Protein Antigen

  • B2 bradykinin receptor
  • B2R
  • BDKRB2
  • BK-2 receptor
  • BK2
  • BK-2
  • BKR2
  • Bradykinin RB2
  • bradykinin receptor B2
  • BradykininRB2
  • BRB2
  • DKFZp686O088

Background

BDKRB2, or Bradykinin Receptor B2, mediates smooth muscle contraction, induces relaxation of arteries, and stimulates diuresis. In addition, bradykinin B2 receptor has been implicated in inflammation and response to pain. This receptor is encoded by a single-copy gene. Two variants are produced by alternate start codons. BDKRB2/Bradykinin B2 receptor expression has been reported in blood, brain, eye, kidney, liver, lung, prostate, skin, small intestine, synovium, uterus, and vessel. ESTs have been isolated from colon, connective tissue, heart, heart/melanocyte/uterus, kidney, lung, placenta, and thyroid libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kininogen Antibody
NBP1-89993
Immunohistochemistry-Paraffin Kininogen Antibody
Immunohistochemistry-Paraffin Kininogen Antibody
Western Blot Kininogen Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Bradykinin
RB1/BDKRB1 Antibody - ...
NLS799
Immunohistochemistry-Paraffin Bradykinin RB1/BDKRB1 Antibody - BSA Free
Immunohistochemistry-Paraffin Bradykinin RB1/BDKRB1 Antibody - BSA Free
Immunohistochemistry-Paraffin Bradykinin RB1/BDKRB1 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
PLEKHM1 Antibody
NBP2-38449
Immunohistochemistry-Paraffin PLEKHM1 Antibody
Immunohistochemistry-Paraffin PLEKHM1 Antibody
Immunohistochemistry-Paraffin PLEKHM1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
SPANXB1 Antibody
H00728695-B01P
Immunocytochemistry/ Immunofluorescence SPANXB1 Antibody
Western Blot SPANXB1 Antibody
Species: Hu
Applications: ICC/IF, IP, WB
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot CD20 Antibody (AISB12) - BSA Free
Flow Cytometry CD20 Antibody (AISB12) - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin BBS9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
eNOS Antibody -
BSA Free
NB300-500
Western Blot eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
(3 Reviews)
(28 Publications)
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Kallikrein 1
Antibody (323803) [Un ...
MAB2337
Kallikrein 1 Antibody (323803) [Unconjugated]
(1 Review)
Species: Hu
Applications: IP, WB
AGTR-1 Antibody -
BSA Free
NBP1-77078
Immunohistochemistry-Paraffin AGTR-1 Antibody - BSA Free
Immunohistochemistry-Paraffin AGTR-1 Antibody - BSA Free
Western Blot AGTR-1 Antibody - BSA Free
(10 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
GPR151 Antibody -
BSA Free
NLS418
Immunohistochemistry-Paraffin GPR151 Antibody - BSA Free
Immunohistochemistry-Paraffin GPR151 Antibody - BSA Free
Immunohistochemistry-Paraffin GPR151 Antibody - BSA Free
Species: Hu
Applications: IHC, IHC-P
Lgr6 Antibody
(918719) [Unconjugate
MAB8458
Flow Cytometry Lgr6 Antibody (918719) [Unconjugated]
Immunocytochemistry Lgr6 Antibody (918719) [Unconjugated]
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, ICC

Publications for Bradykinin RB2/BDKRB2 Protein (NBP2-14351PEP) (0)

There are no publications for Bradykinin RB2/BDKRB2 Protein (NBP2-14351PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bradykinin RB2/BDKRB2 Protein (NBP2-14351PEP) (0)

There are no reviews for Bradykinin RB2/BDKRB2 Protein (NBP2-14351PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Bradykinin RB2/BDKRB2 Protein (NBP2-14351PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Bradykinin RB2/BDKRB2 Products

Research Areas for Bradykinin RB2/BDKRB2 Protein (NBP2-14351PEP)

Find related products by research area.

Blogs on Bradykinin RB2/BDKRB2

There are no specific blogs for Bradykinin RB2/BDKRB2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
EphB2 Antibody [Unconjugated]
AF467

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Bradykinin RB2/BDKRB2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BDKRB2