![Western Blot: npp-16 Antibody [48590002]](http://images.novusbio.com/fullsize/npp-16-Antibody-Western-Blot-48590002-img0003.jpg "Western Blot: npp-16 Antibody [48590002]")
| Immunogen | In vivo generated recominant protein fragment |
| Epitope | MNSLIPPPTSEQQMNMFRLRDKMSLLNAEFLKVINGYFTEKNHYDFSGTMKSYMDHVAQLKQIYKVDDDVAADMTVPRRTENSSESSGETVAPRKIAKAV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NPP16 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This product is useful for ELISA, Western Blot, and Immunofluorescence. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl |
| Preservative | No Preservative |
| Concentration | 1 mg/ml |
| Purity | Immunogen affinity purified |
| Publication using 48590002 | Applications | Species |
|---|---|---|
| Thomas L, Taleb Ismail B, Askjaer P, Seydoux G Nucleoporin foci are stress-sensitive condensates dispensable for C. elegans nuclear pore assembly The EMBO journal 2023-07-03 [PMID: 37254647] (IHC-WhMt, C. elegans) Details: Dilution 1:250 |
IHC-WhMt | C. elegans |
Secondary Antibodies |
Isotype Controls |
Research Areas for npp-16 Antibody (48590002)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NPP16 |
![Immunocytochemistry/Immunofluorescence: npp-16 Antibody [48590002] - This image is specific to animal number SDQ4093 Wild-type (N2) and npp-16 mutant (RB1534) mixed-stage embryos; freeze-thaw MeOH preparation; 1% formaldehyde fixation Primary antibodies: 1:1000 SDQ4093; 1:400 (anti-NPC control) Secondary antibodies: 1:200 anti-rabbit Alexa 488; 1:100 anti-mouse Texas Red DAPI staining](http://images.novusbio.com/fullsize/npp-16-Antibody-Immunocytochemistry-Immunofluorescence-48590002-img0005.jpg "Immunocytochemistry/Immunofluorescence: npp-16 Antibody [48590002] - This image is specific to animal number SDQ4093 Wild-type (N2) and npp-16 mutant (RB1534) mixed-stage embryos; freeze-thaw MeOH preparation; 1% formaldehyde fixation Primary antibodies: 1:1000 SDQ4093; 1:400 (anti-NPC control) Secondary antibodies: 1:200 anti-rabbit Alexa 488; 1:100 anti-mouse Texas Red DAPI staining")
![Immunocytochemistry/Immunofluorescence: npp-16 Antibody [48590002] - This image is specific to animal number SDQ3896 Wild-type (N2) and npp-16 mutant (RB1534) mixed-stage embryos; freeze-thaw MeOH preparation; 1% formaldehyde fixation Primary antibodies: 1:1000 SDQ3896; 1:400 (anti-NPC control) Secondary antibodies: 1:200 anti-rabbit Alexa 488; 1:100 anti-mouse Texas Red DAPI staining](http://images.novusbio.com/fullsize/npp-16-Antibody-Immunocytochemistry-Immunofluorescence-48590002-img0004.jpg "Immunocytochemistry/Immunofluorescence: npp-16 Antibody [48590002] - This image is specific to animal number SDQ3896 Wild-type (N2) and npp-16 mutant (RB1534) mixed-stage embryos; freeze-thaw MeOH preparation; 1% formaldehyde fixation Primary antibodies: 1:1000 SDQ3896; 1:400 (anti-NPC control) Secondary antibodies: 1:200 anti-rabbit Alexa 488; 1:100 anti-mouse Texas Red DAPI staining")