![Western Blot: his-24 Antibody [48500002] This image is specific to animal number SDQ3996 Experimental Design: dilution 1:1000 of SDQ3996 and 1:10000 dilution of donkey-anti-rabbit-HRP secondary antibody. As controls for equal loading a western with 1:10000 dilution of anti-tublin was carried out on the stripped membrane. The membrane was also stained with coomaissie. The first lane contained mixed stage N2 worms. The second lane conatined mixed stage his-24 (OK1024) worms.](http://images.novusbio.com/fullsize/his-24-Antibody-Western-Blot-48500002-img0002.jpg "Western Blot: his-24 Antibody [48500002] This image is specific to animal number SDQ3996 Experimental Design: dilution 1:1000 of SDQ3996 and 1:10000 dilution of donkey-anti-rabbit-HRP secondary antibody. As controls for equal loading a western with 1:10000 dilution of anti-tublin was carried out on the stripped membrane. The membrane was also stained with coomaissie. The first lane contained mixed stage N2 worms. The second lane conatined mixed stage his-24 (OK1024) worms.")
| Immunogen | In vivo generated recombinant protein fragment |
| Epitope | PPYINMIKEAIKQLKDRKGASKQAILKFISQNYKLGDNVIQINAHLRQALKRGVTSKALVQAAGSGANGRF |
| Specificity | Caenorhabditis elegans Histone H1.1 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This product is useful in ELISA and Western Blot. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl |
| Preservative | No Preservative |
| Concentration | 1 mg/ml |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for his-24 Antibody (48500002)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: his-24 Antibody [48500002] This image is specific to animal number SDQ3969 dilution 1:6,000+ of 1 mg/mL.](http://images.novusbio.com/fullsize/his-24-Antibody-Western-Blot-48500002-img0001.jpg "Western Blot: his-24 Antibody [48500002] This image is specific to animal number SDQ3969 dilution 1:6,000+ of 1 mg/mL.")