capg-1 Antibody Summary
| Immunogen |
In vivo generated recominant protein fragment |
| Epitope |
MPPKKRIRGPKLPALREEKSTGTDVASDESFNESADFLNNEELNNDQNDAENTVLSEGVSTLRINENMTKEDRACISAALFIKKRVVESIRTVFQSRDDI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Western Blot 1:100-1:2000
|
| Application Notes |
This product is useful in ELISA and Western Blot. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl |
| Preservative |
No Preservative |
| Purity |
Immunogen affinity purified |
Notes
This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.
Alternate Names for capg-1 Antibody
Background
This product was created as a part of the ModEncode Project, a part of the National Human Genome Research Institute (NHGRI) and is made available through SDIX and Novus Biologicals for commercial and non-profit use. This antibody is available from different lot and animal productions. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Publications for capg-1 Antibody (48460002) (0)
There are no publications for capg-1 Antibody (48460002).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for capg-1 Antibody (48460002) (0)
There are no reviews for capg-1 Antibody (48460002).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for capg-1 Antibody (48460002) (0)
Secondary Antibodies
| |
Isotype Controls
|
Research Areas for capg-1 Antibody (48460002)
Find related products by research area.
|
Blogs on capg-1
![Western Blot: capg-1 Antibody [48460002] - This image is specific to animal number SDQ3967 Dilution 1:1000](http://images.novusbio.com/fullsize/capg-1-Antibody-Western-Blot-48460002-img0003.jpg "Western Blot: capg-1 Antibody [48460002] - This image is specific to animal number SDQ3967 Dilution 1:1000")
![Western Blot: capg-1 Antibody [48460002] This image is specific to animal number SDQ3990](http://images.novusbio.com/fullsize/capg-1-Antibody-Western-Blot-48460002-img0002.jpg "Western Blot: capg-1 Antibody [48460002] This image is specific to animal number SDQ3990")