![Western Blot: Rapsyn Antibody [NBP1-85537] - (A) HeLa and (B) C2C12 cells were treated with the indicated siRNAs for 2 days and cellular lysates were subjected to Western blot analysis using Rapsyn antibody. GAPDH was used as loading control. Rapsyn protein levels are reduced in NUP88-depleted cells. Image collected and cropped by CiteAb from the following publication (//journals.plos.org/plosgenetics/article?id=10.1371/journal.pgen.1007845) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Rapsyn-Antibody-Western-Blot-NBP1-85537-img0009.jpg "Western Blot: Rapsyn Antibody [NBP1-85537] - (A) HeLa and (B) C2C12 cells were treated with the indicated siRNAs for 2 days and cellular lysates were subjected to Western blot analysis using Rapsyn antibody. GAPDH was used as loading control. Rapsyn protein levels are reduced in NUP88-depleted cells. Image collected and cropped by CiteAb from the following publication (//journals.plos.org/plosgenetics/article?id=10.1371/journal.pgen.1007845) licensed under a CC-BY license.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARKALDKALDAIE |
| Predicted Species | Mouse (94%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAPSN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-85537 | Applications | Species |
|---|---|---|
| Jühlen R, Martinelli V, Rencurel C, Fahrenkrog B Alteration of actin cytoskeletal organisation in fetal akinesia deformation sequence bioRxiv 2023-06-12 (ICC/IF, Human) | ICC/IF | Human |
| Bonnin E, Cabochette P, Filosa A et al. Biallelic mutations in nucleoporin NUP88 cause lethal fetal akinesia deformation sequence PLoS Genet. [PMID: 30543681] (WB, IF/IHC, Human) | WB, IF/IHC | Human |
| Juhlen R, Breckpot J, Fahrenkrog B Centrosome and ciliary abnormalities in fetal akinesia deformation sequence human fibroblasts bioRxiv (ICC/IF) | ICC/IF | |
| Juhlen R, Breckpot J, Fahrenkrog B Centrosome and ciliary abnormalities in fetal akinesia deformation sequence human fibroblasts Sci Rep 2020-11-10 [PMID: 33168876] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Rapsyn Antibody (NBP1-85537)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAPSN |
![Immunocytochemistry/Immunofluorescence: Rapsyn Antibody [NBP1-85537] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.](http://images.novusbio.com/fullsize/Rapsyn-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85537-img0007.jpg "Immunocytochemistry/Immunofluorescence: Rapsyn Antibody [NBP1-85537] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.")
![Immunohistochemistry-Paraffin: Rapsyn Antibody [NBP1-85537] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/Rapsyn-Antibody-Immunohistochemistry-Paraffin-NBP1-85537-img0008.jpg "Immunohistochemistry-Paraffin: Rapsyn Antibody [NBP1-85537] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.")
![Loss of functional NUP88 affects rapsyn expression as well as AChR clustering.(A) HeLa and (B) C2C12 cells were treated with the indicated siRNAs for 2 days and cellular lysates were subjected to Western blot analysis using antibodies against NUP88, CRM1, MuSK, NF-kB, and rapsyn. GAPDH was used as loading control. Rapsyn protein levels are reduced in NUP88-depleted cells. Note MuSK has a predicted molecular weight of 97 kDa, but migrates higher [20]. (C) Quantification of the respective expression levels of NUP88 and rapsyn after transfection of HeLa and C2C12 cells with the indicated siRNAs and shRNA-mediated depletion of NUP88 in C2C12 cells. Blots from three independent experiments for each condition were analyzed. Data present mean +/- SEM. P-values ****<0.0001, ***<0.001; **<0.01, *<0.05; t-test, one-tailed. (D) Bright-field images of histological muscle sections from individual B.II.2 and a control fetus stained with anti-rapsyn antibodies (brown). Nuclei were visualized by hematoxylin. (E) qRT-PCR analysis of nup88 and rapsn transcripts in 5 dpf wild-type and nup88-/- larvae. (F) Skeletal muscle organization remains unaffected in nup88-/- zebrafish larvae. Larvae were prepared at 5 dpf for transmission electron microscopy. Skeletal muscle of WT and mutant zebrafish show intact myofibril alignment with their regularly stacked Z-line and clearly identifiable H- and I-zones. Shown are representative longitudinal sections of skeletal muscle from nup88+/+ and nup88-/- larvae, respectively. Scale bar, 1 um. (G) Anterior trunk regions of wild-type (left) and nup88 heterozygous and homozygous mutant larvae were stained with antibodies against the AChR and secondary Alexa 488 antibodies. AChR cluster size was significantly reduced in nup88-/- larvae as compared to nup88+/+ and nup88+/- larvae (higher magnification insets). Insets are taken from the marked area in the respective overview image. Inset for nup88-/- was rotated by 180. Scale bars, 50 um (overview), 5 um (insets). (H) Quantification of the AChR size in 4 dpf nup88+/+ (n = 8), nup88+/- (n = 14), and nup88-/- (n = 12) larvae. Per larvae 100 clusters throughout z-stacks of confocal images were manually measured using ImageJ. Data present mean +/- SD. P-values ****<0.0001, ***<0.001; t-test, one-tailed. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30543681), licensed under a CC-BY licence.](http://images.novusbio.com/fullsize/nbp1-85537_rabbit-polyclonal-rapsyn-antibody-291220231215661.jpg "Loss of functional NUP88 affects rapsyn expression as well as AChR clustering.(A) HeLa and (B) C2C12 cells were treated with the indicated siRNAs for 2 days and cellular lysates were subjected to Western blot analysis using antibodies against NUP88, CRM1, MuSK, NF-kB, and rapsyn. GAPDH was used as loading control. Rapsyn protein levels are reduced in NUP88-depleted cells. Note MuSK has a predicted molecular weight of 97 kDa, but migrates higher [20]. (C) Quantification of the respective expression levels of NUP88 and rapsyn after transfection of HeLa and C2C12 cells with the indicated siRNAs and shRNA-mediated depletion of NUP88 in C2C12 cells. Blots from three independent experiments for each condition were analyzed. Data present mean +/- SEM. P-values ****<0.0001, ***<0.001; **<0.01, *<0.05; t-test, one-tailed. (D) Bright-field images of histological muscle sections from individual B.II.2 and a control fetus stained with anti-rapsyn antibodies (brown). Nuclei were visualized by hematoxylin. (E) qRT-PCR analysis of nup88 and rapsn transcripts in 5 dpf wild-type and nup88-/- larvae. (F) Skeletal muscle organization remains unaffected in nup88-/- zebrafish larvae. Larvae were prepared at 5 dpf for transmission electron microscopy. Skeletal muscle of WT and mutant zebrafish show intact myofibril alignment with their regularly stacked Z-line and clearly identifiable H- and I-zones. Shown are representative longitudinal sections of skeletal muscle from nup88+/+ and nup88-/- larvae, respectively. Scale bar, 1 um. (G) Anterior trunk regions of wild-type (left) and nup88 heterozygous and homozygous mutant larvae were stained with antibodies against the AChR and secondary Alexa 488 antibodies. AChR cluster size was significantly reduced in nup88-/- larvae as compared to nup88+/+ and nup88+/- larvae (higher magnification insets). Insets are taken from the marked area in the respective overview image. Inset for nup88-/- was rotated by 180. Scale bars, 50 um (overview), 5 um (insets). (H) Quantification of the AChR size in 4 dpf nup88+/+ (n = 8), nup88+/- (n = 14), and nup88-/- (n = 12) larvae. Per larvae 100 clusters throughout z-stacks of confocal images were manually measured using ImageJ. Data present mean +/- SD. P-values ****<0.0001, ***<0.001; t-test, one-tailed. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30543681), licensed under a CC-BY licence.")
![Immunohistochemistry-Paraffin: Rapsyn Antibody [NBP1-85537] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/antibody/nbp1-85537_rabbit-polyclonal-rapsyn-antibody-immunohistochemistry-paraffin-2062024124021..jpg "Immunohistochemistry-Paraffin: Rapsyn Antibody [NBP1-85537] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: Rapsyn Antibody [NBP1-85537] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-85537_rabbit-polyclonal-rapsyn-antibody-immunohistochemistry-paraffin-2062024124116..jpg "Immunohistochemistry-Paraffin: Rapsyn Antibody [NBP1-85537] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: Rapsyn Antibody [NBP1-85537] - Staining of human skin shows very weak positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-85537_rabbit-polyclonal-rapsyn-antibody-immunohistochemistry-paraffin-2062024124216..jpg "Immunohistochemistry-Paraffin: Rapsyn Antibody [NBP1-85537] - Staining of human skin shows very weak positivity in squamous epithelial cells as expected.")
![Immunohistochemistry Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Immunohistochemistry_11019.jpg)
![Western Blot Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Western_Blot_11065.jpg)
![Knockout Validated Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Knockout_Validated_23118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")