![Western Blot: PRA1 Antibody [NBP1-80883] - Analysis in control (vector only transfected HEK293T lysate) and RABAC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/PRA1-Antibody-Western-Blot-NBP1-80883-img0012.jpg "Western Blot: PRA1 Antibody [NBP1-80883] - Analysis in control (vector only transfected HEK293T lysate) and RABAC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRP |
| Predicted Species | Mouse (95%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RABAC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot TSHR Antibody (484405) [Unconjugated]](https://images.novusbio.com/images2/TSH_R_MAB6534_Western_Blot_10858.jpg)
![ELISA TSHR Antibody (484405) [Unconjugated]](https://images.novusbio.com/images2/TSH_R_MAB6534_ELISA_21565.jpg)
| Publication using NBP1-80883 | Applications | Species |
|---|---|---|
| Lampinen, R, R Mitochondrial dysfunction in non-neuronal cells in Alzheimer's disease Thesis 2022-01-01 |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PRA1 Antibody [NBP1-80883] - Staining of human cell line U-251 MG shows localization to nucleoli fibrillar center and nuclear membrane.](http://images.novusbio.com/fullsize/PRA1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80883-img0011.jpg "Immunocytochemistry/Immunofluorescence: PRA1 Antibody [NBP1-80883] - Staining of human cell line U-251 MG shows localization to nucleoli fibrillar center and nuclear membrane.")
![Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining in human cerebral cortex and liver tissues using anti-RABAC1 antibody. Corresponding RABAC1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PRA1-Antibody-Immunohistochemistry-Paraffin-NBP1-80883-img0010.jpg "Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining in human cerebral cortex and liver tissues using anti-RABAC1 antibody. Corresponding RABAC1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PRA1-Antibody-Immunohistochemistry-Paraffin-NBP1-80883-img0002.jpg "Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/PRA1-Antibody-Immunohistochemistry-Paraffin-NBP1-80883-img0008.jpg "Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/PRA1-Antibody-Immunohistochemistry-Paraffin-NBP1-80883-img0009.jpg "Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_2_AF1730_Immunocytochemistry_6474.jpg)
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1730_human-integrin-beta-2-cd18-affinity-purified-polyclonal-ab-immunocytochemistry-1292023225343.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")