![Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/JM4-Antibody-Western-Blot-NBP1-87886-img0004.jpg "Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINN |
| Predicted Species | Mouse (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PRAF2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-87886 | Applications | Species |
|---|---|---|
| Koomoa DL, Go RC, Wester K et al. Expression profile of PRAF2 in the human brain and enrichment in synaptic vesicles. Neurosci Lett 2008-05-01 [PMID: 18395978] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PRAF2 |
![Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/JM4-Antibody-Immunohistochemistry-Paraffin-NBP1-87886-img0009.jpg "Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).](http://images.novusbio.com/fullsize/JM4-Antibody-Western-Blot-NBP1-87886-img0003.jpg "Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).")
![Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding PRAF2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/JM4-Antibody-Immunohistochemistry-Paraffin-NBP1-87886-img0005.jpg "Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding PRAF2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/JM4-Antibody-Immunohistochemistry-Paraffin-NBP1-87886-img0006.jpg "Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/JM4-Antibody-Immunohistochemistry-Paraffin-NBP1-87886-img0007.jpg "Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/JM4-Antibody-Immunohistochemistry-Paraffin-NBP1-87886-img0008.jpg "Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.")
![Flow Cytometry CCR5 Antibody (45531) [Unconjugated]](https://images.novusbio.com/images2/CCR5_MAB182_Flow_Cytometry_22407.jpg)
![Neutralization CCR5 Antibody (45531) [Unconjugated]](https://images.novusbio.com/images2/CCR5_MAB182_Block_Neutralize_9044.jpg)
![Immunocytochemistry CCR5 Antibody (45531) [Unconjugated]](https://images.novusbio.com/images2/CCR5_MAB182_Immunocytochemistry_9681.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")