![Western Blot: NDNL2 Antibody (4F7) [H00056160-M02-100ug] - Detection against Immunogen (31.35 KDa) .](http://images.novusbio.com/fullsize/NDNL2-Antibody-4F7-Western-Blot-H00056160-M02-100ug-img0002.jpg "Western Blot: NDNL2 Antibody (4F7) [H00056160-M02-100ug] - Detection against Immunogen (31.35 KDa) .")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 4F7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | NDNL2 (NP_619649.1, 2 a.a. ~ 52 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSR |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | NDNL2 |
| Purity | Protein A or G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A or G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NDNL2 |
| Entrez |
|
| OMIM |
|
| Uniprot |
|
![ELISA: NDNL2 Antibody (4F7) [H00056160-M02-100ug] - Detection limit for recombinant GST tagged NDNL2 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/NDNL2-Antibody-4F7-ELISA-H00056160-M02-100ug-img0001.jpg "ELISA: NDNL2 Antibody (4F7) [H00056160-M02-100ug] - Detection limit for recombinant GST tagged NDNL2 is 0.3 ng/ml as a capture antibody.")
![Western Blot VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Western_Blot_16711.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Immunohistochemistry_7144.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images/af2030_human-vasa-affinity-purified-polyclonal-ab-4120241239493.jpg)
