MAGEL2 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEL2 (Q9UJ55.1). Peptide sequence MQGLFYRPQGSSKERRTSSKERRAPSKDRMIFAATFCAPKAVSAARAHLP |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MAGEL2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
58 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for MAGEL2 Antibody
Background
Prader-Willi syndrome (PWS) is caused by the loss of expression of imprinted genes in chromosome 15q11-q13. Affected individuals exhibit neonatal hypotonia, developmental delay, and childhood-onset obesity. Necdin (NDN), a gene involved in the terminal differentiation of neurons, localizes to this region of the genome and has been implicated as one of the genes responsible for the etiology of PWS. This gene is structurally similar to NDN, is also localized to the PWS chromosomal region, and is paternally imprinted, suggesting a possible role for it in PWS. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu
Applications: ELISA, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Publications for MAGEL2 Antibody (NBP3-09393) (0)
There are no publications for MAGEL2 Antibody (NBP3-09393).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MAGEL2 Antibody (NBP3-09393) (0)
There are no reviews for MAGEL2 Antibody (NBP3-09393).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MAGEL2 Antibody (NBP3-09393) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MAGEL2 Products
Blogs on MAGEL2