![SDS-Page: Recombinant Human Twist-1 Protein [H00007291-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://images.novusbio.com/fullsize/qc_test-H00007291-Q01-1.jpg "SDS-Page: Recombinant Human Twist-1 Protein [H00007291-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, PAGE, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 100-202 of Human Twist-1 Source: Wheat Germ (in vitro) Amino Acid Sequence: PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | TWIST1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 37.07 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Research Areas for Twist-1 Partial Recombinant Protein (H00007291-Q01)Find related products by research area.
|
|
Autophagy and Metastasis By Christina Towers, PhD The majority of cancer patients die from metastatic disease at secondary sites. The threshold to undergo metastasis is high. Only a minority of cancer cells acquire invasive phenotypes... Read full blog post. |
|
Epithelial-Mesenchymal Transition (EMT) Markers Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TWIST1 |
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![Western Blot Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Western_Blot_5320.jpg)
![Intracellular Staining by Flow Cytometry Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Flow_Cytometry_20834.jpg)
![Chromatin Immunoprecipitation (ChIP) Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Chromatin_Immunoprecipitation_11236.jpg)
![Immunohistochemistry FGFR3 Antibody (136312) [Unconjugated] - (IIIc)](https://images.novusbio.com/images2/FGF_R3_MAB7662_Immunohistochemistry_23319.jpg)
![Flow Cytometry FGFR3 Antibody (136312) [Unconjugated] - (IIIc)](https://images.novusbio.com/images2/mab7662_human-fgf-r3-iiic-mab-clone-136312-flow-cytometry-2112202112199.jpg)
![Immunocytochemistry FGFR3 Antibody (136312) [Unconjugated] - (IIIc)](https://images.novusbio.com/images2/mab7662_human-fgf-r3-iiic-mab-clone-136312-immunocytochemistry-186202172236.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Flow Cytometry: Twist-1 Antibody (10E4E6) [NBP2-37364] - An intracellular stain was performed on HeLa cells with Twist-1 Antibody (10E4E6)NBP2-37364R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Dylight 550.](https://images.novusbio.com/images/Twist-1-Antibody-10E4E6-Flow-Cytometry-NBP2-37364-img0012.jpg "Flow Cytometry: Twist-1 Antibody (10E4E6) [NBP2-37364] - An intracellular stain was performed on HeLa cells with Twist-1 Antibody (10E4E6)NBP2-37364R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Dylight 550.")