![Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.](http://images.novusbio.com/fullsize/ZEB2-Antibody-Western-Blot-NBP1-82991-img0013.jpg "Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Flow, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE |
| Predicted Species | Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZEB2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Xizi Wu |
IHC-Fr | Mouse | 11/08/2019 |
Summary
Comments
|
||||||||||
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 11/12/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for ZEB2 Antibody (NBP1-82991)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Xizi Wu 11/08/2019 |
||
| Application: | IHC-Fr | |
| Species: | Mouse |
| Verified Customer 11/12/2017 |
||
| Application: | WB | |
| Species: | Human |
| Gene Symbol | ZEB2 |
![Western Blot: ZEB2 Antibody [NBP1-82991] - Depletion of TRIM14 increased ZEB2 polyubiquitination and proteasomal degradation. Western blot analysis of TRIM14, ZEB2 and beta-actin in LN229 and U251 cells transduced with the indicated shRNA in the absence or presence of 10uM MG132. Image collected and cropped by CiteAb from the following publication (//jeccr.biomedcentral.com/articles/10.1186/s13046-019-1070-x), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/ZEB2-Antibody-Western-Blot-NBP1-82991-img0018.jpg "Western Blot: ZEB2 Antibody [NBP1-82991] - Depletion of TRIM14 increased ZEB2 polyubiquitination and proteasomal degradation. Western blot analysis of TRIM14, ZEB2 and beta-actin in LN229 and U251 cells transduced with the indicated shRNA in the absence or presence of 10uM MG132. Image collected and cropped by CiteAb from the following publication (//jeccr.biomedcentral.com/articles/10.1186/s13046-019-1070-x), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human pancreas shows no positivity as expected.](http://images.novusbio.com/fullsize/ZEB2-Antibody-Immunohistochemistry-Paraffin-NBP1-82991-img0017.jpg "Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human pancreas shows no positivity as expected.")
![Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.](http://images.novusbio.com/fullsize/ZEB2-Antibody-Immunohistochemistry-Paraffin-NBP1-82991-img0014.jpg "Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.")
![Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.](http://images.novusbio.com/fullsize/ZEB2-Antibody-Immunohistochemistry-Paraffin-NBP1-82991-img0015.jpg "Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.")
![Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human glioma shows moderate nuclear positivity in tumor cells.](http://images.novusbio.com/fullsize/ZEB2-Antibody-Immunohistochemistry-Paraffin-NBP1-82991-img0016.jpg "Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human glioma shows moderate nuclear positivity in tumor cells.")
![Western Blot Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Western_Blot_5320.jpg)
![Intracellular Staining by Flow Cytometry Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Flow_Cytometry_20834.jpg)
![Chromatin Immunoprecipitation (ChIP) Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Chromatin_Immunoprecipitation_11236.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/DATA_MMP2_MMP200_ELISA_1003.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/MMP2_MMP200_ELISA_474.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
