![Immunohistochemistry-Paraffin: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Analysis of human pancreas shows absence of immunoreactivity (negative control).](http://images.novusbio.com/fullsize/SLC6A3-DAT1-Antibody-3123-Immunohistochemistry-NBP2-46649-img0007.jpg "Immunohistochemistry-Paraffin: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Analysis of human pancreas shows absence of immunoreactivity (negative control).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clone | CL3123 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LHYLFSSFTTELPWNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLG |
| Epitope | ELPWIHCNNSWNSPN |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLC6A3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC6A3/DAT1 Antibody (NBP2-46649)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Staining of rat striatum shows strong immunoreactivity in dopaminergic fibers.](http://images.novusbio.com/fullsize/SLC6A3-DAT1-Antibody-3123-Immunohistochemistry-NBP2-46649-img0001.jpg "Immunohistochemistry: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Staining of rat striatum shows strong immunoreactivity in dopaminergic fibers.")
![Immunohistochemistry: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Staining of mouse striatum shows strong immunoreactivity in dopaminergic fibers.](http://images.novusbio.com/fullsize/SLC6A3-DAT1-Antibody-3123-Immunohistochemistry-NBP2-46649-img0002.jpg "Immunohistochemistry: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Staining of mouse striatum shows strong immunoreactivity in dopaminergic fibers.")
![Immunohistochemistry-Paraffin: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Staining of human caudate nucleus shows immunoreactivity in dopaminergic fibers.](http://images.novusbio.com/fullsize/SLC6A3-DAT1-Antibody-3123-Immunohistochemistry-NBP2-46649-img0003.jpg "Immunohistochemistry-Paraffin: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Staining of human caudate nucleus shows immunoreactivity in dopaminergic fibers.")
![Immunohistochemistry: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Staining of rat cerebral cortex shows positivity in dopaminergic fibers.](http://images.novusbio.com/fullsize/SLC6A3-DAT1-Antibody-3123-Immunohistochemistry-NBP2-46649-img0004.jpg "Immunohistochemistry: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Staining of rat cerebral cortex shows positivity in dopaminergic fibers.")
![Immunohistochemistry: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Staining of mouse cerebral cortex shows positivity in dopaminergic fibers.](http://images.novusbio.com/fullsize/SLC6A3-DAT1-Antibody-3123-Immunohistochemistry-NBP2-46649-img0005.jpg "Immunohistochemistry: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Staining of mouse cerebral cortex shows positivity in dopaminergic fibers.")
![Immunohistochemistry-Paraffin: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Staining of human substantia nigra shows moderate immunoreactivity in dopamine neurons and fibers.](http://images.novusbio.com/fullsize/SLC6A3-DAT1-Antibody-3123-Immunohistochemistry-NBP2-46649-img0006.jpg "Immunohistochemistry-Paraffin: SLC6A3/DAT1 Antibody (3123) [NBP2-46649] - Staining of human substantia nigra shows moderate immunoreactivity in dopamine neurons and fibers.")
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Immunocytochemistry Nurr1/NGFI-B beta/NR4A2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2156_human-mouse-nurr1-ngfi-b-beta-nr4a2-affinity-purified-pab-immunocytochemistry-22112021145420.jpg)
![Immunohistochemistry Nurr1/NGFI-B beta/NR4A2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2156_human-mouse-nurr1-ngfi-b-beta-nr4a2-affinity-purified-pab-immunohistochemistry-10122021111228.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")