![Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Analysis in human small intestine and lymph node tissues using HPA059299 antibody. Corresponding MAOA RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MAO-A-Antibody-Immunohistochemistry-Paraffin-NBP2-38868-img0010.jpg "Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Analysis in human small intestine and lymph node tissues using HPA059299 antibody. Corresponding MAOA RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAOA |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-38868 | Applications | Species |
|---|---|---|
| Shui X, Ren X, Xu R et al. Monoamine oxidase A drives neuroendocrine differentiation in prostate cancer Biochemical and biophysical research communications 2022-03-23 [PMID: 35349822] (WB, IF/IHC, Human, Mouse) | WB, IF/IHC | Human, Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for MAO-A Antibody (NBP2-38868)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: MAO-A Antibody [NBP2-38868] - Analysis in human cell line RT-4.](http://images.novusbio.com/fullsize/MAO-A-Antibody-Western-Blot-NBP2-38868-img0011.jpg "Western Blot: MAO-A Antibody [NBP2-38868] - Analysis in human cell line RT-4.")
![Immunocytochemistry/Immunofluorescence: MAO-A Antibody [NBP2-38868] - Staining of human cell line RT4 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/MAO-A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38868-img0005.jpg "Immunocytochemistry/Immunofluorescence: MAO-A Antibody [NBP2-38868] - Staining of human cell line RT4 shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human lymph node shows no positivity in germinal center cells as expected.](http://images.novusbio.com/fullsize/MAO-A-Antibody-Immunohistochemistry-Paraffin-NBP2-38868-img0006.jpg "Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human lymph node shows no positivity in germinal center cells as expected.")
![Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/MAO-A-Antibody-Immunohistochemistry-Paraffin-NBP2-38868-img0007.jpg "Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/MAO-A-Antibody-Immunohistochemistry-Paraffin-NBP2-38868-img0008.jpg "Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/MAO-A-Antibody-Immunohistochemistry-Paraffin-NBP2-38868-img0009.jpg "Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.")
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")