Home » HNF-3 beta/FoxA2 » HNF-3 beta/FoxA2 Proteins » Recombinant Human HNF-3 beta/FoxA2 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human HNF-3 beta/FoxA2 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human HNF-3 beta/FoxA2 Protein [H00003170-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human HNF-3 beta/FoxA2 Protein [H00003170-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related HNF-3 beta/FoxA2 Peptides and Proteins

Order Details


    • Catalog Number
      H00003170-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human HNF-3 beta/FoxA2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 363-457 of Human HNF-3 beta/FoxA2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FOXA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HNF-3 beta/FoxA2 GST (N-Term) Protein

  • forkhead box A2
  • Forkhead box protein A2
  • FoxA2
  • hepatic nuclear factor-3-beta
  • hepatocyte nuclear factor 3, beta
  • hepatocyte nuclear factor 3-beta
  • HNF3 beta
  • HNF-3 beta
  • HNF-3B
  • HNF-3-beta
  • HNF3BTCF-3B
  • MGC19807
  • TCF3B
  • Transcription factor 3B

Background

FOXA2 - forkhead box A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HNF-3 alpha/FoxA1
Antibody (3B11NB) - B ...
NBP2-45269
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Western Blot HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
FOXA3 Antibody
NBP2-87461
Immunohistochemistry FOXA3 Antibody
Western Blot FOXA3 Antibody
Western Blot FOXA3 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
HNF1 Antibody
NBP1-33596
Western Blot HNF1 Antibody
Western Blot HNF1 Antibody
Western Blot HNF1 Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
HNF-6/ONECUT1
Antibody [Unconjugate
AF6277
Immunocytochemistry HNF-6/ONECUT1 Antibody [Unconjugated]
Western Blot HNF-6/ONECUT1 Antibody [Unconjugated]
Immunocytochemistry HNF-6/ONECUT1 Antibody [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, WB
Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(65 Publications)
Species: Mu
Applications: BA
FoxM1 Antibody
AF3975
Western Blot FoxM1 Antibody
Immunocytochemistry FoxM1 Antibody
Western Blot FoxM1 Antibody
(2 Publications)
Species: Hu
Applications: ICC, WB
TCF-2/HNF-1 beta
Antibody
NBP1-89680
Immunocytochemistry/ Immunofluorescence TCF-2/HNF-1 beta Antibody
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta Antibody
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
PDX-1/IPF1
Antibody [Unconjugate
AF2419
Western Blot PDX-1/IPF1 Antibody [Unconjugated]
Immunocytochemistry PDX-1/IPF1 Antibody [Unconjugated]
Simple Western PDX-1/IPF1 Antibody [Unconjugated]
(70 Publications)
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Immunohistochemistry-Paraffin HNF-4 alpha/NR2A1 Antibody
Immunohistochemistry-Paraffin HNF-4 alpha/NR2A1 Antibody
Western Blot HNF-4 alpha/NR2A1 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...
NBP2-44501
Immunohistochemistry TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
SOX17 Antibody
[Unconjugated]
AF1924
Chromatin Immunoprecipitation (ChIP) SOX17 Antibody [Unconjugated]
Simple Western SOX17 Antibody [Unconjugated]
Immunocytochemistry SOX17 Antibody [Unconjugated]
(3 Reviews)
(460 Publications)
Species: Hu
Applications: ChIP, ICC, Simple Western, WB

Transthyretin/Prealbum ...
NBP2-52575
Flow Cytometry Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MLX Antibody
[Unconjugated]
AF4186
Western Blot MLX Antibody [Unconjugated]
Immunocytochemistry MLX Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC, WB
PDHX Antibody
NBP1-84079
Immunohistochemistry-Paraffin PDHX Antibody
Immunohistochemistry-Paraffin PDHX Antibody
Immunohistochemistry-Paraffin PDHX Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(72 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Recombinant Human
HNF-3 beta/FoxA2 GST ...
H00003170-Q01
Recombinant Human HNF-3 beta/FoxA2 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01) (0)

There are no publications for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01) (0)

There are no reviews for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HNF-3 beta/FoxA2 Products

Blogs on HNF-3 beta/FoxA2

There are no specific blogs for HNF-3 beta/FoxA2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HNF-3 beta/FoxA2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol FOXA2