Home » TCF-2/HNF-1 beta » TCF-2 Peptides and Proteins » TCF-2/HNF-1 beta Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TCF-2/HNF-1 beta Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TCF-2/HNF-1 beta Protein (NBP1-89680PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

TCF-2/HNF-1 beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNF1B.

Source: E. coli

Amino Acid Sequence: KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HNF1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89680.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TCF-2/HNF-1 beta Recombinant Protein Antigen

  • FJHN
  • hepatocyte nuclear factor 1-beta
  • HNF1 beta A
  • HNF-1 beta
  • HNF1 homeobox B
  • HNF1B
  • HNF-1B
  • HNF1beta
  • HNF-1-beta
  • HNF2
  • Homeoprotein LFB3
  • LFB3
  • LF-B3
  • MODY5
  • MODY5HPC11
  • TCF2
  • TCF-2
  • TCF2transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor
  • Transcription factor 2
  • transcription factor 2, hepatic
  • Variant hepatic nuclear factor 1
  • VHNF1

Background

TCF2 encodes transcription factor 2, a liver-specific factor of the homeobox-containing basic helix-turn-helix family. The TCF2 protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1; depending on the TCF2 isoform, the result may be to activate or inhibit transcription of target genes. Mutation of TCF2 that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5). A third human transcript variant is believed to exist based on such a variant in the rat: however, to date such an mRNA species has not been isolated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HNF1 Antibody
NBP1-33596
Western Blot HNF1 Antibody
Western Blot HNF1 Antibody
Western Blot HNF1 Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Immunohistochemistry-Paraffin HNF-4 alpha/NR2A1 Antibody
Immunohistochemistry-Paraffin HNF-4 alpha/NR2A1 Antibody
Western Blot HNF-4 alpha/NR2A1 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Glucokinase/GCK
Antibody (OTI3E3)
NBP1-47778
Immunocytochemistry/ Immunofluorescence Glucokinase/GCK Antibody (OTI3E3)
Immunohistochemistry-Paraffin Glucokinase/GCK Antibody (OTI3E3)
Immunohistochemistry-Paraffin Glucokinase/GCK Antibody (OTI3E3)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MLX Antibody
[Unconjugated]
AF4186
Western Blot MLX Antibody [Unconjugated]
Immunocytochemistry MLX Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC, WB
HNF-6/ONECUT1
Antibody [Unconjugate
AF6277
Immunocytochemistry HNF-6/ONECUT1 Antibody [Unconjugated]
Western Blot HNF-6/ONECUT1 Antibody [Unconjugated]
Immunocytochemistry HNF-6/ONECUT1 Antibody [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, WB
HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
(96 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB
PDX-1/IPF1
Antibody [Unconjugate
AF2419
Western Blot PDX-1/IPF1 Antibody [Unconjugated]
Immunocytochemistry PDX-1/IPF1 Antibody [Unconjugated]
Simple Western PDX-1/IPF1 Antibody [Unconjugated]
(70 Publications)
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Uromodulin
Antibody [Unconjugate
AF5175
Western Blot Uromodulin Antibody [Unconjugated]
Immunohistochemistry Uromodulin Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence Uromodulin Antibody [Unconjugated]
(8 Publications)
Species: Mu
Applications: IHC, WB
PCBD1 Antibody -
BSA Free
NBP2-93878
Western Blot PCBD1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PCBD1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
HNF-3 alpha/FoxA1
Antibody (3B11NB) - B ...
NBP2-45269
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Western Blot HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TCF7/TCF1 Antibody
(812145) [Unconjugate ...
MAB8224
Western Blot TCF7/TCF1 Antibody (812145) [Unconjugated]
Intracellular Staining by Flow Cytometry TCF7/TCF1 Antibody (812145) [Unconjugated]
(3 Publications)
Species: Mu
Applications: CyTOF-ready, ICFlow, WB

alpha-Fetoprotein/AFP ...
MAB1368
Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
(3 Reviews)
(89 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
TCF-2/HNF-1 beta
Recombinant Protein A ...
NBP1-89680PEP
TCF-2/HNF-1 beta Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for TCF-2/HNF-1 beta Protein (NBP1-89680PEP) (0)

There are no publications for TCF-2/HNF-1 beta Protein (NBP1-89680PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF-2/HNF-1 beta Protein (NBP1-89680PEP) (0)

There are no reviews for TCF-2/HNF-1 beta Protein (NBP1-89680PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TCF-2/HNF-1 beta Protein (NBP1-89680PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TCF-2/HNF-1 beta Products

Research Areas for TCF-2/HNF-1 beta Protein (NBP1-89680PEP)

Find related products by research area.

Blogs on TCF-2/HNF-1 beta

There are no specific blogs for TCF-2/HNF-1 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TCF-2/HNF-1 beta Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HNF1B